Human TLR4

Goat

Human (tested or 100% immunogen sequence identity)

IgG Polyclonal

Unconjugated

Affinity purified

Unmodified

Synthetic peptide LIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC corresponding to amino acids 161-192 within the N-Terminus of Human CD284. Percent identity by BLAST analysis: Human, Chimpanzee, Orangutan, Gibbon (100%); Gorilla, Baboon, Monkey (97%); Hamster (87%); Sheep, Goat, Dolphin, Zebu, Bovine, Guinea pig (84%); Panda, Cat, Pig (81%).

aa161-192

Recognizes the human Toll-like receptor 4, also known as CD284, hToll or TLR4. CD284 is an 839 amino acid ~96 kD single pass type I transmembrane glycoprotein expressed by peripheral blood leucocytes, activated T cells, monocytes, macrophages, dendritic cells, granulocytes and endothelial cells. CD284 plays a primary role in the activation of innate immunity. Recognizes an epitope within the N-terminal (NT) region of CD284, a highly conserved member of the toll-like receptor family which acts as a receptor for bacterial lipopolysaccharides (LPS) in co-operation with CD14 and MD2 (LY96), resulting in the activation of the MyD88-dependent and MyD88-independent (TRIF-dependent) signalling pathways and the production of inflammatory cytokines. LPS-activated CD284 can also induce dendritic cell maturation via TRIF-dependent signaling. Is reported to be suitable for use in immunocytochemistry on acetone fixed cells.

• IHC
• IHC - Paraffin (1:100 - 1:300)
• Western blot (1:1000)

PBS, 0.1% Sodium Azide, 0.1% BSA

Short term: store at 4°C. Long term: aliquot and store at -20°C. Avoid freeze-thaw cycles.

For research use only. Intended for use by laboratory professionals.

This antibody carries the LSBio 100% Guarantee.

Uniprot: O00206 NCBI: NM_138554 O00206