Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Location


Corporate Headquarters

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Telephone Numbers



Customer Service: (800) 227-6666 / (650) 697-3600


Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C407947-10 10 µg $318 
LS-C407947-100 100 µg $470 
PDPK1 / PDK1 Antibody - IHC analysis of PDPK1 using anti-PDPK1 antibody. PDPK1 was detected in frozen section of human placenta tissue . Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-PDPK1 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
PDPK1 / PDK1 Antibody - IHC analysis of PDPK1 using anti-PDPK1 antibody. PDPK1 was detected in frozen section of mouse small intestine tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-PDPK1 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
PDPK1 / PDK1 Antibody - PDPK1 antibody IHC-paraffin. IHC(P): Human Lung Cancer Tissue.
PDPK1 / PDK1 Antibody - PDPK1 antibody IHC-paraffin. IHC(P): Mouse Intestine Tissue.
PDPK1 / PDK1 Antibody - PDPK1 antibody IHC-paraffin. IHC(P): Rat Testis Tissue.
PDPK1 / PDK1 Antibody - PDPK1 antibody Western blot. All lanes: Anti PDPK1 at 0.5 ug/ml. Lane 1: Rat Liver Tissue Lysate at 50 ug. Lane 2: Rat Lung Tissue Lysate at 50 ug. Lane 3: Mouse Liver Tissue Lysate at 50 ug. Lane 4: Mouse Lung Tissue Lysate at 50 ug. Lane 5: COLO320 Whole Cell Lysate at 40 ug. Lane 6: MCF-7 Whole Cell Lysate at 40 ug. Predicted band size: 70 kD. Observed band size: 70 kD.
PDPK1 / PDK1 Antibody - IHC analysis of PDPK1 using anti-PDPK1 antibody. PDPK1 was detected in frozen section of human placenta tissue . Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-PDPK1 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
PDPK1 / PDK1 Antibody - IHC analysis of PDPK1 using anti-PDPK1 antibody. PDPK1 was detected in frozen section of mouse small intestine tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-PDPK1 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
PDPK1 / PDK1 Antibody - PDPK1 antibody IHC-paraffin. IHC(P): Human Lung Cancer Tissue.
PDPK1 / PDK1 Antibody - PDPK1 antibody IHC-paraffin. IHC(P): Mouse Intestine Tissue.
PDPK1 / PDK1 Antibody - PDPK1 antibody IHC-paraffin. IHC(P): Rat Testis Tissue.
PDPK1 / PDK1 Antibody - PDPK1 antibody Western blot. All lanes: Anti PDPK1 at 0.5 ug/ml. Lane 1: Rat Liver Tissue Lysate at 50 ug. Lane 2: Rat Lung Tissue Lysate at 50 ug. Lane 3: Mouse Liver Tissue Lysate at 50 ug. Lane 4: Mouse Lung Tissue Lysate at 50 ug. Lane 5: COLO320 Whole Cell Lysate at 40 ug. Lane 6: MCF-7 Whole Cell Lysate at 40 ug. Predicted band size: 70 kD. Observed band size: 70 kD.
1 of 6
2 of 6
3 of 6
4 of 6
5 of 6
6 of 6

Polyclonal Rabbit anti‑Human PDPK1 / PDK1 Antibody (aa524‑556, IHC, WB) LS‑C407947

Polyclonal Rabbit anti‑Human PDPK1 / PDK1 Antibody (aa524‑556, IHC, WB) LS‑C407947

Antibody:
PDPK1 / PDK1 Rabbit anti-Human Polyclonal (aa524-556) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat, Guinea pig
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C407947-10
Toll Free North America
(800) 227-6666
For Research Use Only

Overview

Antibody:
PDPK1 / PDK1 Rabbit anti-Human Polyclonal (aa524-556) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat, Guinea pig
Format:
Unconjugated, Unmodified

Specifications

Description
PDK1 antibody LS-C407947 is an unconjugated rabbit polyclonal antibody to PDK1 (PDPK1) (aa524-556) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
Target
Human PDPK1 / PDK1
Synonyms
PDPK1 | HPDK1 | PkB kinase like gene 1 | PkB-like 1 | Pdk-1 | PkB kinase | PRO0461
Host
Rabbit
Reactivity
Human, Mouse, Rat, Guinea pig (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence at the C-Terminus of human PDPK1 (524-556 aa YLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ), different from the related mouse and rat sequences by two amino acids.
Epitope
aa524-556
Specificity
Appears to be expressed ubiquitously. The Tyr- 9 phosphorylated form is markedly increased in diseased tissue compared with normal tissue from lung, liver, colon and breast. .
Applications
  • IHC
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Presentation
Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About PDPK1 / PDK1
O15530 NM_002613 NP_002604.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 11/23/2024