LSBio logo with text
Products
Research Areas
COVID-19
Resources
Contact Us
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Cart
How To Buy
Contact Us

Location

Corporate Headquarters

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Telephone Numbers


Customer Service: (800) 227-6666 / (650) 697-3600


Contact Us


Additional Contact Details

Distributors
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Antibodies > APRT > LS-C662161
 
Print Page  
Catalog Number Size Price
LS-C662161-10 10 µg $318 
LS-C662161-100 100 µg $470 
APRT Antibody - Western blot analysis of APRT using anti-APRT antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. lane 1: K562 whole cell lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-APRT antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for APRT at approximately 20KD. The expected band size for APRT is at 20KD.
APRT Antibody - Flow Cytometry analysis of A549 cells using anti-APRT antibody. Overlay histogram showing A549 cells stained with anti-APRT antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-APRT Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
APRT Antibody - Flow Cytometry analysis of PC-3 cells using anti-APRT antibody. Overlay histogram showing PC-3 cells stained with anti-APRT antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-APRT Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
APRT Antibody - Western blot analysis of APRT using anti-APRT antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. lane 1: K562 whole cell lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-APRT antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for APRT at approximately 20KD. The expected band size for APRT is at 20KD.
APRT Antibody - Flow Cytometry analysis of A549 cells using anti-APRT antibody. Overlay histogram showing A549 cells stained with anti-APRT antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-APRT Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
APRT Antibody - Flow Cytometry analysis of PC-3 cells using anti-APRT antibody. Overlay histogram showing PC-3 cells stained with anti-APRT antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-APRT Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
1 of 3
2 of 3
3 of 3

Polyclonal Rabbit anti‑Human APRT Antibody (aa5‑49, IHC, WB) LS‑C662161

Polyclonal Rabbit anti‑Human APRT Antibody (aa5‑49, IHC, WB) LS‑C662161

Submit Review LSBio Guarantee
Antibody:
APRT Rabbit anti-Human Polyclonal (aa5-49) Antibody
Application:
IHC, IHC-Fr, ICC, WB, Flo
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C662161-10
Toll Free North America
(800) 227-6666
For Research Use Only
Specifications Validation Publications Reviews Featured Products Request SDS/MSDS

Overview

Antibody:
APRT Rabbit anti-Human Polyclonal (aa5-49) Antibody
Application:
IHC, IHC-Fr, ICC, WB, Flo
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
APRT antibody LS-C662161 is an unconjugated rabbit polyclonal antibody to human APRT (aa5-49). Validated for Flow, ICC, IHC and WB.
Target
Human APRT
Synonyms
APRT | AMP | AMP diphosphorylase | APRTD | AMP pyrophosphorylase | Transphosphoribosidase
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence at the N-Terminus of human APRT (5-49 aa ELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARH), different from the related mouse sequence by ten amino acids, and from the related rat sequence by nine amino acids.
Epitope
aa5-49
Applications
  • IHC
  • IHC - Frozen
  • ICC
  • Western blot
  • Flow Cytometry
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Presentation
Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About APRT
P07741 NM_000485 NP_000476.1

Publications (0)

Submit a Publication for LS-C662161

Customer Reviews (0)

Submit a review for LS-C662161

Featured Products

APRT Antibody - Formalin-fixed and paraffin-embedded human hepatocarcinoma with APRT Antibody , which was peroxidase-conjugated to the secondary antibody, followed by DAB staining. This data demonstrates the use of this antibody for immunohistochemistry; clinical relevance has not been evaluated.
APRT Antibody (aa12‑40) LS‑C156439
Species: Human
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, Flow Cytometry
APRT Antibody - Anti-APRT antibody IHC staining of human lung. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml. This image was taken for the unconjugated form of this product. Other forms have not been tested.
APRT Antibody (N‑Terminus) LS‑B10419
Species: Human
Applications: IHC, IHC - Paraffin, Western blot
APRT Antibody - Immunofluorescent analysis of APRT staining in A549 cells. Formalin-fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 5-10 minutes and blocked with 3% BSA-PBS for 30 minutes at room temperature. Cells were probed with the primary antibody in 3% BSA-PBS and incubated overnight at 4 deg C in a humidified chamber. Cells were washed with PBST and incubated with a DyLight 594-conjugated secondary antibody (red) in PBS at room temperature in the dark.
APRT Antibody LS‑C482448
Species: Human, Mouse, Rat
Applications: ICC, Immunofluorescence, Western blot
APRT Antibody - Immunohistochemistry of paraffin-embedded mouse lung using APRT Antibody at dilution of 1:100 (40x lens).
APRT Antibody (aa1‑180) LS‑C748961
Species: Human, Mouse, Rat
Applications: IHC, Western blot
EPO / Erythropoietin Protein - Recombinant Erythropoietin By SDS-PAGE
Human EPO / Erythropoietin Protein (Recombinant His-GST) (aa28-193) - LS-G11249
Source: E. coli
Tag: His-GST
See all APRT Antibodies

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com
Requested From: United States
Date Requested: 11/22/2024
Family of Companies
Site Links Home All Antibodies How To Buy All Proteins Distributors All ELISA & Assay Kits Reviews PathPlus™ Antibodies
Follow LSBio View Cart Register or Login
Copyright © 2024 LifeSpan BioSciences, Inc - Privacy Policy
Contact Us

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Tel: (800) 227-6666 / (650) 697-3600

To place an order:
customerservice@vectorlabs.com

For questions about orders:
Customer.Support@LSBio.com

For technical assistance:
Technical.Support@LSBio.com