Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Location


Corporate Headquarters

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Telephone Numbers



Customer Service: (800) 227-6666 / (650) 697-3600


Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C357554-10 10 µg $318 
LS-C357554-100 100 µg (0.5 mg/ml) $470 
AIFM1 / AIF / PDCD8 Antibody - AIF antibody IHC-paraffin: Human Intestinal Cancer Tissue.
AIFM1 / AIF / PDCD8 Antibody - AIF antibody IHC-paraffin: Rat Cardiac Muscle Tissue.
AIFM1 / AIF / PDCD8 Antibody - AIF antibody IHC-paraffin: Mouse Cardiac Muscle Tissue.
AIFM1 / AIF / PDCD8 Antibody - AIF antibody ICC: SMMC-7721 Cell.
AIFM1 / AIF / PDCD8 Antibody - Western blot analysis of AIF using anti-AIF antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat spleen tissue lysates, Lane 2: rat ovary tissue lysates, Lane 3: rat lung tissue lysates, Lane 4: rat liver tissue lysates, Lane 5: mouse spleen tissue lysates, Lane 6: mouse testis tissue lysates, Lane 7: mouse lung tissue lysates, Lane 8: mouse liver tissue lysates, Lane 9: mouse ovary tissue lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-AIF antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for AIF at approximately 67KD. The expected band size for AIF is at 67KD.
AIFM1 / AIF / PDCD8 Antibody - Western blot analysis of AIF using anti-AIF antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human placenta tissue lysates, Lane 2: human A549 whole cell lysates, Lane 3: human PC-3 whole cell lysates, Lane 4: human K562 whole cell lysates, Lane 5: human Caco-2 whole cell lysates, Lane 6: human Hela whole cell lysates, Lane 7: human HL-60 whole cell lysates, Lane 8: human U-87MG whole cell lysates, After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-AIF antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for AIF at approximately 67KD. The expected band size for AIF is at 67KD.
AIFM1 / AIF / PDCD8 Antibody - AIF antibody Western blot. All lanes: Anti AIF at 0.5 ug/ml. Lane 1: Rat Kidney Tissue Lysate at 50 ug. Lane 2: Rat Brain Tissue Lysate at 50 ug. Lane 3: Mouse Stomach Tissue Lysate at 50 ug. Lane 4: Mouse Spleen Tissue Lysate at 50 ug. Lane 5: HELA Whole Cell Lysate at 40 ug. Lane 6: U87 Whole Cell Lysate at 40 ug. Lane 7: PANC Whole Cell Lysate at 40 ug. Predicted band size: 67 kD. Observed band size: 85 kD.
AIFM1 / AIF / PDCD8 Antibody - AIF antibody IHC-paraffin: Human Intestinal Cancer Tissue.
AIFM1 / AIF / PDCD8 Antibody - AIF antibody IHC-paraffin: Rat Cardiac Muscle Tissue.
AIFM1 / AIF / PDCD8 Antibody - AIF antibody IHC-paraffin: Mouse Cardiac Muscle Tissue.
AIFM1 / AIF / PDCD8 Antibody - AIF antibody ICC: SMMC-7721 Cell.
AIFM1 / AIF / PDCD8 Antibody - Western blot analysis of AIF using anti-AIF antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat spleen tissue lysates, Lane 2: rat ovary tissue lysates, Lane 3: rat lung tissue lysates, Lane 4: rat liver tissue lysates, Lane 5: mouse spleen tissue lysates, Lane 6: mouse testis tissue lysates, Lane 7: mouse lung tissue lysates, Lane 8: mouse liver tissue lysates, Lane 9: mouse ovary tissue lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-AIF antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for AIF at approximately 67KD. The expected band size for AIF is at 67KD.
AIFM1 / AIF / PDCD8 Antibody - Western blot analysis of AIF using anti-AIF antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human placenta tissue lysates, Lane 2: human A549 whole cell lysates, Lane 3: human PC-3 whole cell lysates, Lane 4: human K562 whole cell lysates, Lane 5: human Caco-2 whole cell lysates, Lane 6: human Hela whole cell lysates, Lane 7: human HL-60 whole cell lysates, Lane 8: human U-87MG whole cell lysates, After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-AIF antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for AIF at approximately 67KD. The expected band size for AIF is at 67KD.
AIFM1 / AIF / PDCD8 Antibody - AIF antibody Western blot. All lanes: Anti AIF at 0.5 ug/ml. Lane 1: Rat Kidney Tissue Lysate at 50 ug. Lane 2: Rat Brain Tissue Lysate at 50 ug. Lane 3: Mouse Stomach Tissue Lysate at 50 ug. Lane 4: Mouse Spleen Tissue Lysate at 50 ug. Lane 5: HELA Whole Cell Lysate at 40 ug. Lane 6: U87 Whole Cell Lysate at 40 ug. Lane 7: PANC Whole Cell Lysate at 40 ug. Predicted band size: 67 kD. Observed band size: 85 kD.
1 of 7
2 of 7
3 of 7
4 of 7
5 of 7
6 of 7
7 of 7

Polyclonal Rabbit anti‑Human AIFM1 / AIF / PDCD8 Antibody (aa582‑613, IHC, WB) LS‑C357554

Polyclonal Rabbit anti‑Human AIFM1 / AIF / PDCD8 Antibody (aa582‑613, IHC, WB) LS‑C357554

Antibody:
AIFM1 / AIF / PDCD8 Rabbit anti-Human Polyclonal (aa582-613) Antibody
Application:
IHC, IHC-P, ICC, WB
Reactivity:
Human, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Hamster, Horse, Pig, Rabbit
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C357554-10
Toll Free North America
(800) 227-6666
For Research Use Only

Overview

Antibody:
AIFM1 / AIF / PDCD8 Rabbit anti-Human Polyclonal (aa582-613) Antibody
Application:
IHC, IHC-P, ICC, WB
Reactivity:
Human, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Hamster, Horse, Pig, Rabbit
Format:
Unconjugated, Unmodified

Specifications

Description
PDCD8 antibody LS-C357554 is an unconjugated rabbit polyclonal antibody to PDCD8 (AIFM1 / AIF) (aa582-613) from human. It is reactive with human, mouse, rat and other species. Validated for ICC, IHC and WB.
Target
Human AIFM1 / AIF / PDCD8
Synonyms
AIFM1 | AIF | COXPD6 | PDCD8 | Programmed cell death 8
Host
Rabbit
Reactivity
Human, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Hamster, Horse, Pig, Rabbit (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence at the C-Terminus of human AIF(582-613 aa FNRMPIARKIIKDGEQHEDLNEVAKLFNIHED), identical to the related mouse and rat sequences.
Epitope
aa582-613
Specificity
Detected in muscle and skin fibroblasts (at protein level). Isoform 5 is frequently down-regulated in human cancers. .
Applications
  • IHC
  • IHC - Paraffin
  • ICC
  • Western blot
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Presentation
Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About AIFM1 / AIF / PDCD8
O95831 NM_004208 NP_004199.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 1/28/2025