LSBio logo with text
Products
Research Areas
COVID-19
Resources
Contact Us
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Cart
How To Buy
Contact Us

Location

Corporate Headquarters

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Telephone Numbers


Customer Service: (800) 227-6666 / (650) 697-3600


Contact Us


Additional Contact Details

Distributors
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Antibodies > AIFM1 / AIF / PDCD8 > LS-C357554
 
Print Page  
Catalog Number Size Price
LS-C357554-10 10 µg $318 
LS-C357554-100 100 µg (0.5 mg/ml) $470 
AIFM1 / AIF / PDCD8 Antibody - AIF antibody IHC-paraffin: Human Intestinal Cancer Tissue.
AIFM1 / AIF / PDCD8 Antibody - AIF antibody IHC-paraffin: Rat Cardiac Muscle Tissue.
AIFM1 / AIF / PDCD8 Antibody - AIF antibody IHC-paraffin: Mouse Cardiac Muscle Tissue.
AIFM1 / AIF / PDCD8 Antibody - AIF antibody ICC: SMMC-7721 Cell.
AIFM1 / AIF / PDCD8 Antibody - Western blot analysis of AIF using anti-AIF antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat spleen tissue lysates, Lane 2: rat ovary tissue lysates, Lane 3: rat lung tissue lysates, Lane 4: rat liver tissue lysates, Lane 5: mouse spleen tissue lysates, Lane 6: mouse testis tissue lysates, Lane 7: mouse lung tissue lysates, Lane 8: mouse liver tissue lysates, Lane 9: mouse ovary tissue lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-AIF antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for AIF at approximately 67KD. The expected band size for AIF is at 67KD.
AIFM1 / AIF / PDCD8 Antibody - Western blot analysis of AIF using anti-AIF antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human placenta tissue lysates, Lane 2: human A549 whole cell lysates, Lane 3: human PC-3 whole cell lysates, Lane 4: human K562 whole cell lysates, Lane 5: human Caco-2 whole cell lysates, Lane 6: human Hela whole cell lysates, Lane 7: human HL-60 whole cell lysates, Lane 8: human U-87MG whole cell lysates, After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-AIF antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for AIF at approximately 67KD. The expected band size for AIF is at 67KD.
AIFM1 / AIF / PDCD8 Antibody - AIF antibody Western blot. All lanes: Anti AIF at 0.5 ug/ml. Lane 1: Rat Kidney Tissue Lysate at 50 ug. Lane 2: Rat Brain Tissue Lysate at 50 ug. Lane 3: Mouse Stomach Tissue Lysate at 50 ug. Lane 4: Mouse Spleen Tissue Lysate at 50 ug. Lane 5: HELA Whole Cell Lysate at 40 ug. Lane 6: U87 Whole Cell Lysate at 40 ug. Lane 7: PANC Whole Cell Lysate at 40 ug. Predicted band size: 67 kD. Observed band size: 85 kD.
AIFM1 / AIF / PDCD8 Antibody - AIF antibody IHC-paraffin: Human Intestinal Cancer Tissue.
AIFM1 / AIF / PDCD8 Antibody - AIF antibody IHC-paraffin: Rat Cardiac Muscle Tissue.
AIFM1 / AIF / PDCD8 Antibody - AIF antibody IHC-paraffin: Mouse Cardiac Muscle Tissue.
AIFM1 / AIF / PDCD8 Antibody - AIF antibody ICC: SMMC-7721 Cell.
AIFM1 / AIF / PDCD8 Antibody - Western blot analysis of AIF using anti-AIF antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat spleen tissue lysates, Lane 2: rat ovary tissue lysates, Lane 3: rat lung tissue lysates, Lane 4: rat liver tissue lysates, Lane 5: mouse spleen tissue lysates, Lane 6: mouse testis tissue lysates, Lane 7: mouse lung tissue lysates, Lane 8: mouse liver tissue lysates, Lane 9: mouse ovary tissue lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-AIF antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for AIF at approximately 67KD. The expected band size for AIF is at 67KD.
AIFM1 / AIF / PDCD8 Antibody - Western blot analysis of AIF using anti-AIF antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human placenta tissue lysates, Lane 2: human A549 whole cell lysates, Lane 3: human PC-3 whole cell lysates, Lane 4: human K562 whole cell lysates, Lane 5: human Caco-2 whole cell lysates, Lane 6: human Hela whole cell lysates, Lane 7: human HL-60 whole cell lysates, Lane 8: human U-87MG whole cell lysates, After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-AIF antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for AIF at approximately 67KD. The expected band size for AIF is at 67KD.
AIFM1 / AIF / PDCD8 Antibody - AIF antibody Western blot. All lanes: Anti AIF at 0.5 ug/ml. Lane 1: Rat Kidney Tissue Lysate at 50 ug. Lane 2: Rat Brain Tissue Lysate at 50 ug. Lane 3: Mouse Stomach Tissue Lysate at 50 ug. Lane 4: Mouse Spleen Tissue Lysate at 50 ug. Lane 5: HELA Whole Cell Lysate at 40 ug. Lane 6: U87 Whole Cell Lysate at 40 ug. Lane 7: PANC Whole Cell Lysate at 40 ug. Predicted band size: 67 kD. Observed band size: 85 kD.
1 of 7
2 of 7
3 of 7
4 of 7
5 of 7
6 of 7
7 of 7

Polyclonal Rabbit anti‑Human AIFM1 / AIF / PDCD8 Antibody (aa582‑613, IHC, WB) LS‑C357554

Polyclonal Rabbit anti‑Human AIFM1 / AIF / PDCD8 Antibody (aa582‑613, IHC, WB) LS‑C357554

Submit Review LSBio Guarantee
Antibody:
AIFM1 / AIF / PDCD8 Rabbit anti-Human Polyclonal (aa582-613) Antibody
Application:
IHC, IHC-P, ICC, WB
Reactivity:
Human, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Hamster, Horse, Pig, Rabbit
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C357554-10
Toll Free North America
(800) 227-6666
For Research Use Only
Specifications Validation Publications Reviews Featured Products Request SDS/MSDS

Overview

Antibody:
AIFM1 / AIF / PDCD8 Rabbit anti-Human Polyclonal (aa582-613) Antibody
Application:
IHC, IHC-P, ICC, WB
Reactivity:
Human, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Hamster, Horse, Pig, Rabbit
Format:
Unconjugated, Unmodified

Specifications

Description
PDCD8 antibody LS-C357554 is an unconjugated rabbit polyclonal antibody to PDCD8 (AIFM1 / AIF) (aa582-613) from human. It is reactive with human, mouse, rat and other species. Validated for ICC, IHC and WB.
Target
Human AIFM1 / AIF / PDCD8
Synonyms
AIFM1 | AIF | COXPD6 | PDCD8 | Programmed cell death 8
Host
Rabbit
Reactivity
Human, Gibbon, Monkey, Mouse, Rat, Bat, Bovine, Hamster, Horse, Pig, Rabbit (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence at the C-Terminus of human AIF(582-613 aa FNRMPIARKIIKDGEQHEDLNEVAKLFNIHED), identical to the related mouse and rat sequences.
Epitope
aa582-613
Specificity
Detected in muscle and skin fibroblasts (at protein level). Isoform 5 is frequently down-regulated in human cancers. .
Applications
  • IHC
  • IHC - Paraffin
  • ICC
  • Western blot
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Presentation
Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About AIFM1 / AIF / PDCD8
O95831 NM_004208 NP_004199.1

Publications (0)

Submit a Publication for LS-C357554

Customer Reviews (0)

Submit a review for LS-C357554

Featured Products

AIFM1 / AIF / PDCD8 Antibody - IHC of AIF in formalin-fixed, paraffin-embedded normal human colon using AIFM1 / AIF / PDCD8 Antibody at 1:2000. Hematoxylin-Eosin counterstain. In this example, AIF expression is predominant in the upper part of the crypt.
AIFM1 / AIF / PDCD8 Antibody (aa151‑169) LS‑C147989
Species: Human, Monkey, Mouse, Rat, Bat, Bovine, Dog, Hamster, Horse, Pig, Rabbit
Applications: IHC, IHC - Paraffin, IHC - Frozen, Western blot, Immunoprecipitation
AIFM1 / AIF / PDCD8 Antibody - Anti-AIFM1 / AIF antibody IHC of human kidney, tubules. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody dilution 5 ug/ml.
IHC‑plus™ AIFM1 / AIF / PDCD8 Antibody LS‑B7901
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Western blot
AIFM1 / AIF / PDCD8 Antibody - Formalin-fixed and paraffin-embedded human brain tissue reacted with AIFM1 Antibody , which was peroxidase-conjugated to the secondary antibody, followed by DAB staining. This data demonstrates the use of this antibody for immunohistochemistry; clinical relevance has not been evaluated.
AIFM1 / AIF / PDCD8 Antibody (aa70‑98) LS‑C156184
Species: Human
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, Flow Cytometry
AIFM1 / AIF / PDCD8 Antibody - Anti-AIFM1 / AIF antibody IHC of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml. This image was taken for the unconjugated form of this product. Other forms have not been tested.
AIFM1 / AIF / PDCD8 Antibody (aa211‑260) LS‑B1508
Species: Human, Mouse
Applications: IHC, IHC - Paraffin, Western blot
AIFM1 / AIF / PDCD8 Antibody - Anti-AIFM1 / AIF antibody IHC of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
IHC‑plus™ AIFM1 / AIF / PDCD8 Antibody LS‑B3765
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, ICC, Western blot, ELISA
AIFM1 / AIF / PDCD8 Antibody - Immunohistochemical analysis of AIFM1 staining in human brain formalin fixed paraffin embedded tissue section. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH 6.0). The section was then incubated with the antibody at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with hematoxylin and mounted with DPX.
AIFM1 / AIF / PDCD8 Antibody (N‑Terminus) LS‑C353147
Species: Human, Mouse, Rat, Sheep
Applications: IHC, IHC - Paraffin, ICC, Immunofluorescence, Western blot, Immunoprecipitation
See all AIFM1 / AIF / PDCD8 Antibodies

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com
Requested From: United States
Date Requested: 12/25/2024
Family of Companies
Site Links Home All Antibodies How To Buy All Proteins Distributors All ELISA & Assay Kits Reviews PathPlus™ Antibodies
Follow LSBio View Cart Register or Login
Copyright © 2024 LifeSpan BioSciences, Inc - Privacy Policy
Contact Us

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Tel: (800) 227-6666 / (650) 697-3600

Orders:
customerservice@vectorlabs.com

For technical assistance:
Technical.Support@LSBio.com