Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Forgot password?
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Quick Order
Products
Antibodies
ELISA and Assay Kits
Research Areas
Infectious Disease
Resources
Purchasing
Reference Material
Contact Us
Location
Corporate Headquarters
Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States
Telephone Numbers
Customer Service: (800) 227-6666 / (650) 697-3600
Contact Us
Additional Contact Details
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Forgot password?
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Quick Order
| Catalog Number | Size | Price |
|---|---|---|
| LS-G136393-20 | 20 µg | $405 |
| LS-G136393-100 | 100 µg | $598 |
| LS-G136393-1 | 1 mg | $1,679 |
1 of 3
2 of 3
3 of 3
Rat ARTN / Artemin Protein (Recombinant 10His, N-terminus + Myc, C-terminus) (Full Length) - LS-G136393
Rat ARTN / Artemin Protein (Recombinant 10His, N-terminus + Myc, C-terminus) (Full Length) - LS-G136393
Description:
ARTN / Artemin Protein LS-G136393 is a Recombinant Rat ARTN / Artemin produced in E. coli 112-224aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only
Toll Free North America
(800) 227-6666
(800) 227-6666For Research Use Only
Overview
Description:
ARTN / Artemin Protein LS-G136393 is a Recombinant Rat ARTN / Artemin produced in E. coli 112-224aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only
Specifications
Type
Recombinant Protein
Target
ARTN / Artemin
Synonyms
ARTN | ENOVIN | EVN | Neurotrophic factor | Artemin | Neublastin
Species
Rat
Modifications
Unmodified
Conjugations
Unconjugated
Tag
10His, N-terminus + Myc, C-terminus
Region
112-224aa
Predicted Molecular Weight
17.1 kDa
AA Sequence
AGTRSSRARATDARGCRLRSQLVPVSALGLGHSSDELIRFRFCSGSCRRARSPHDLSLASLLDAGALRSPPGSRPISQPCCRPTRYEAVSFMDVNSTWRTVDHLSATACGCLG
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 85% by SDS-PAGE
Usage Summary
Ligand for the GFR-alpha-3-RET receptor complex but can also activate the GFR-alpha-1-RET receptor complex. Supports the survival of sensory and sympathetic peripheral neurons in culture and also supports the survival of dopaminergic neurons of the ventral mid-brain. Strong attractant of gut hematopoietic cells thus promoting the formation Peyer's patch-like structures, a major component of the gut-associated lymphoid tissue (By similarity).
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
About ARTN / Artemin
Publications (0)
Customer Reviews (0)
Images
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rat Artemin(Artn) could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Artn.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rat Artemin(Artn) could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Artn.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rat Artemin(Artn) could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Artn.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rat Artemin(Artn) could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Artn.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rat Artemin(Artn) could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Artn.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rat Artemin(Artn) could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Artn.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rat Artemin(Artn) could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Artn.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rat Artemin(Artn) could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Artn.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.
Popular ARTN / Artemin Proteins
Source:
E. coli
Tag:
His, N-Terminal
Request SDS/MSDS
To request an SDS/MSDS form for this product, please contact our Technical Support department at:
Technical.Support@LSBio.com
Requested From: United States
Date Requested: 11/21/2024
Date Requested: 11/21/2024
