Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Forgot password?
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Quick Order
Products
Antibodies
ELISA and Assay Kits
Research Areas
Infectious Disease
Resources
Purchasing
Reference Material
Contact Us
Location
Corporate Headquarters
Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States
Telephone Numbers
Customer Service: (800) 227-6666 / (650) 697-3600
Contact Us
Additional Contact Details
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Forgot password?
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Quick Order
| Catalog Number | Size | Price |
|---|---|---|
| LS-G82-5 | 5 µg | $268 |
| LS-G82-20 | 20 µg | $349 |
Human FST / Follistatin Protein (Recombinant) - LS-G82
Human FST / Follistatin Protein (Recombinant) - LS-G82
Description:
FST / Follistatin Protein LS-G82 is a Recombinant Human FST / Follistatin produced in E. coli. It is biologically active and is low in endotoxin; Less than 0.1 ng/µg of protein (less than 1EU/µg). For Research Use Only
Toll Free North America
(800) 227-6666
(800) 227-6666For Research Use Only
Overview
Description:
FST / Follistatin Protein LS-G82 is a Recombinant Human FST / Follistatin produced in E. coli. It is biologically active and is low in endotoxin; Less than 0.1 ng/µg of protein (less than 1EU/µg). For Research Use Only
Specifications
Type
Recombinant Protein
Target
FST / Follistatin
Synonyms
FST | Activin-binding protein | Follistatin isoform FST317 | Follistatin | Fs
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Predicted Molecular Weight
31.5 kDa
AA Sequence
GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 95% by SDS-PAGE and HPLC
Bio-Activity
Determined by its ability to neutralize Activin A inhibitory effect of murine MPC-11 cells. The expected ED50 is 0.1-0.4 ug/ml in the presence of 7.5 ng/ml Activin A.
Endotoxin
Less than 0.1 ng/µg of protein (less than 1EU/µg).
Presentation
Sterile filtered, lyophilized from 10 mM sodium phosphate, ph 7.5, 75 mM sodium chloride
Reconstitution
Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex.
Storage
If lyophilized, can be stored for 1 month at room temperature, 6 months at 4°C, or through the expiration date at -20°C to -80°C. Once reconstituted per the supplied instructions, can be stored for 3 months at -20°C to -80°C, or for 1 week at 2°C to 8°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
About FST / Follistatin
LSBio Ratings
Human FST / Follistatin Protein (Recombinant) - LS-G82 has an LSBio Rating of
Publications (4.1)
Learn more about The LSBio Ratings Algorithm
Publications (2)
Detection of black market follistatin 344. Christian Reichel, Günter Gmeiner, Mario Thevis. Drug testing and analysis. 2020 October;12:1522-1533.
Detection of black market follistatin 344. Christian Reichel, Günter Gmeiner, Mario Thevis. Drug testing and analysis. 2019 November;11:1675-1697.
Customer Reviews (0)
Popular FST / Follistatin Proteins
Request SDS/MSDS
To request an SDS/MSDS form for this product, please contact our Technical Support department at:
Technical.Support@LSBio.com
Requested From: United States
Date Requested: 11/22/2024
Date Requested: 11/22/2024
