Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Forgot password?
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Quick Order
Products
Antibodies
ELISA and Assay Kits
Research Areas
Infectious Disease
Resources
Purchasing
Reference Material
Contact Us
Location
Corporate Headquarters
Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States
Telephone Numbers
Customer Service: (800) 227-6666 / (650) 697-3600
Contact Us
Additional Contact Details
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Forgot password?
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Quick Order
| Catalog Number | Size | Price |
|---|---|---|
| LS-G136466-20 | 20 µg | $364 |
| LS-G136466-100 | 100 µg | $500 |
| LS-G136466-1 | 1 mg | $1,679 |
1 of 3
2 of 3
3 of 3
Mouse Adiponectin Protein (Recombinant 6His, N-terminus) (Full Length) - LS-G136466
Mouse Adiponectin Protein (Recombinant 6His, N-terminus) (Full Length) - LS-G136466
Description:
Adiponectin Protein LS-G136466 is a Recombinant Mouse Adiponectin produced in E. coli 18-247aa with 6His, N-terminus tag(s). For Research Use Only
Toll Free North America
(800) 227-6666
(800) 227-6666For Research Use Only
Overview
Description:
Adiponectin Protein LS-G136466 is a Recombinant Mouse Adiponectin produced in E. coli 18-247aa with 6His, N-terminus tag(s). For Research Use Only
Specifications
Type
Recombinant Protein
Target
Adiponectin
Synonyms
ADIPOQ | Adiponectin | ADPN | ACDC | ADIPQTL1 | APM-1 | APM1 | ACRP30 | Gelatin-binding protein 28 | GBP28 | Gelatin-binding protein
Species
Mouse
Modifications
Unmodified
Conjugations
Unconjugated
Tag
6His, N-terminus
Region
18-247aa
Predicted Molecular Weight
28.9 kDa
AA Sequence
EDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 85% by SDS-PAGE
Usage Summary
Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW.
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
About Adiponectin
Publications (0)
Customer Reviews (0)
Images
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Adiponectin(Adipoq) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Adipoq.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Adiponectin(Adipoq) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Adipoq.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Adiponectin(Adipoq) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Adipoq.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Adiponectin(Adipoq) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Adipoq.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Adiponectin(Adipoq) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Adipoq.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Adiponectin(Adipoq) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Adipoq.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Adiponectin(Adipoq) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Adipoq.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Adiponectin(Adipoq) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Adipoq.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Popular Adiponectin Proteins
Request SDS/MSDS
To request an SDS/MSDS form for this product, please contact our Technical Support department at:
Technical.Support@LSBio.com
Requested From: United States
Date Requested: 12/22/2024
Date Requested: 12/22/2024
