LSBio logo with text
Products
Research Areas
COVID-19
Resources
Contact Us
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Cart
How To Buy
Contact Us

Locations

Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers


Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us


Additional Contact Details

Distributors
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Proteins > MAPT / Tau > LS-G141291
 
Print Page  
Catalog Number Size Price
LS-G141291-100 100 µg $478 
MAPT / Tau Protein - Immunohistochemistry analysis of P301L mouse hippocampus injected with K18 P301L tau PFFs shows seeding of tau pathology at injection site nine weeks post-injection. AT8 (pSer202/pThr205) tau antibody shows tangle-like inclusions. Experiments performed at reMYND N.V.
MAPT / Tau Protein - TEM of recombinant Tau (K18), P301L mutant preformed fibrils (PFFs) at 150kx magnification. HV=80kV.
MAPT / Tau Protein - Thioflavin T is a fluorescent dye that binds to beta sheet-rich structures, such as those in tau fibrils. Upon binding, the emission spectrum of the dye experiences a red-shift and increased fluorescence intensity. Thioflavin T emission curves show increased fluorescence (correlated to tau aggregation) over time in tau preformed fibrils. Tau preformed fibrils seed the formation of new tau fibrils when combined with tau monomers. Thioflavin T ex = 450 nm, em = 485 nm.
MAPT / Tau Protein - SDS-PAGE of ~15 kDa Active Human Tau Protein K18 P301L Preformed Fibrils. Lane 1: MW Ladder. Lane 2: Tau Protein Preformed Fibrils.
MAPT / Tau Protein - Immunohistochemistry analysis of P301L mouse hippocampus injected with K18 P301L tau PFFs shows seeding of tau pathology at injection site nine weeks post-injection. AT8 (pSer202/pThr205) tau antibody shows tangle-like inclusions. Experiments performed at reMYND N.V.
MAPT / Tau Protein - TEM of recombinant Tau (K18), P301L mutant preformed fibrils (PFFs) at 150kx magnification. HV=80kV.
MAPT / Tau Protein - Thioflavin T is a fluorescent dye that binds to beta sheet-rich structures, such as those in tau fibrils. Upon binding, the emission spectrum of the dye experiences a red-shift and increased fluorescence intensity. Thioflavin T emission curves show increased fluorescence (correlated to tau aggregation) over time in tau preformed fibrils. Tau preformed fibrils seed the formation of new tau fibrils when combined with tau monomers. Thioflavin T ex = 450 nm, em = 485 nm.
MAPT / Tau Protein - SDS-PAGE of ~15 kDa Active Human Tau Protein K18 P301L Preformed Fibrils. Lane 1: MW Ladder. Lane 2: Tau Protein Preformed Fibrils.
1 of 4
2 of 4
3 of 4
4 of 4

Human MAPT / Tau Protein (Recombinant) - LS-G141291

Human MAPT / Tau Protein (Recombinant) - LS-G141291

Submit Review LSBio Guarantee
Available for shipment within the USA only
Description:
MAPT / Tau Protein LS-G141291 is a Recombinant Human MAPT / Tau produced in E. coli. For Research Use Only
Price
Catalog Number
$478
LS-G141291-100

Available for USA Shipment Only
Toll Free North America
206-374-1102
For Research Use Only
Specifications Publications Reviews Images Popular MAPT / Tau Proteins Request SDS/MSDS

Overview

Description:
MAPT / Tau Protein LS-G141291 is a Recombinant Human MAPT / Tau produced in E. coli. For Research Use Only

Specifications

Type
Recombinant Protein
Target
MAPT / Tau
Synonyms
MAPT | FTDP-17 | MSTD | Neurofibrillary tangle protein | PHF-tau | MTBT2 | PPND | DDPAC | MAPTL | MTBT1 | Paired helical filament-tau | TAU
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
AA Sequence
SRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVLGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRE
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 95%
Bio-Activity
Thioflavin T emission curve shows increased fluorescence (correlated to tau protein fibrillation) when active tau PFFs are combined with active tau monomers.
Endotoxin
Not Tested
Presentation
10 mM HEPES, pH 7.4, 100 mM NaCl
Storage
Store at -80°C.
Restrictions
For research use only. Intended for use by laboratory professionals. Available for shipment within the USA only
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About MAPT / Tau
NM_016835 P10636

Publications (0)

Submit a Publication for LS-G141291

Customer Reviews (0)

Submit a review for LS-G141291

Images

Immunohistochemistry

MAPT / Tau Protein - Immunohistochemistry analysis of P301L mouse hippocampus injected with K18 P301L tau PFFs shows seeding of tau pathology at injection site nine weeks post-injection. AT8 (pSer202/pThr205) tau antibody shows tangle-like inclusions. Experiments performed at reMYND N.V.
Immunohistochemistry analysis of P301L mouse hippocampus injected with K18 P301L tau PFFs shows seeding of tau pathology at injection site nine weeks post-injection. AT8 (pSer202/pThr205) tau antibody shows tangle-like inclusions. Experiments performed at reMYND N.V.

Electron Microscopy

MAPT / Tau Protein - TEM of recombinant Tau (K18), P301L mutant preformed fibrils (PFFs) at 150kx magnification. HV=80kV.
TEM of recombinant Tau (K18), P301L mutant preformed fibrils (PFFs) at 150kx magnification. HV=80kV.

Electron Microscopy

MAPT / Tau Protein - Thioflavin T is a fluorescent dye that binds to beta sheet-rich structures, such as those in tau fibrils. Upon binding, the emission spectrum of the dye experiences a red-shift and increased fluorescence intensity. Thioflavin T emission curves show increased fluorescence (correlated to tau aggregation) over time in tau preformed fibrils. Tau preformed fibrils seed the formation of new tau fibrils when combined with tau monomers. Thioflavin T ex = 450 nm, em = 485 nm.
Thioflavin T is a fluorescent dye that binds to beta sheet-rich structures, such as those in tau fibrils. Upon binding, the emission spectrum of the dye experiences a red-shift and increased fluorescence intensity. Thioflavin T emission curves show increased fluorescence (correlated to tau aggregation) over time in tau preformed fibrils. Tau preformed fibrils seed the formation of new tau fibrils when combined with tau monomers. Thioflavin T ex = 450 nm, em = 485 nm.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

MAPT / Tau Protein - SDS-PAGE of ~15 kDa Active Human Tau Protein K18 P301L Preformed Fibrils. Lane 1: MW Ladder. Lane 2: Tau Protein Preformed Fibrils.
SDS-PAGE of ~15 kDa Active Human Tau Protein K18 P301L Preformed Fibrils. Lane 1: MW Ladder. Lane 2: Tau Protein Preformed Fibrils.

Immunohistochemistry

MAPT / Tau Protein - Immunohistochemistry analysis of P301L mouse hippocampus injected with K18 P301L tau PFFs shows seeding of tau pathology at injection site nine weeks post-injection. AT8 (pSer202/pThr205) tau antibody shows tangle-like inclusions. Experiments performed at reMYND N.V.
Immunohistochemistry analysis of P301L mouse hippocampus injected with K18 P301L tau PFFs shows seeding of tau pathology at injection site nine weeks post-injection. AT8 (pSer202/pThr205) tau antibody shows tangle-like inclusions. Experiments performed at reMYND N.V.

Electron Microscopy

MAPT / Tau Protein - TEM of recombinant Tau (K18), P301L mutant preformed fibrils (PFFs) at 150kx magnification. HV=80kV.
TEM of recombinant Tau (K18), P301L mutant preformed fibrils (PFFs) at 150kx magnification. HV=80kV.

Electron Microscopy

MAPT / Tau Protein - Thioflavin T is a fluorescent dye that binds to beta sheet-rich structures, such as those in tau fibrils. Upon binding, the emission spectrum of the dye experiences a red-shift and increased fluorescence intensity. Thioflavin T emission curves show increased fluorescence (correlated to tau aggregation) over time in tau preformed fibrils. Tau preformed fibrils seed the formation of new tau fibrils when combined with tau monomers. Thioflavin T ex = 450 nm, em = 485 nm.
Thioflavin T is a fluorescent dye that binds to beta sheet-rich structures, such as those in tau fibrils. Upon binding, the emission spectrum of the dye experiences a red-shift and increased fluorescence intensity. Thioflavin T emission curves show increased fluorescence (correlated to tau aggregation) over time in tau preformed fibrils. Tau preformed fibrils seed the formation of new tau fibrils when combined with tau monomers. Thioflavin T ex = 450 nm, em = 485 nm.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

MAPT / Tau Protein - SDS-PAGE of ~15 kDa Active Human Tau Protein K18 P301L Preformed Fibrils. Lane 1: MW Ladder. Lane 2: Tau Protein Preformed Fibrils.
SDS-PAGE of ~15 kDa Active Human Tau Protein K18 P301L Preformed Fibrils. Lane 1: MW Ladder. Lane 2: Tau Protein Preformed Fibrils.

Immunohistochemistry

MAPT / Tau Protein - Immunohistochemistry analysis of P301L mouse hippocampus injected with K18 P301L tau PFFs shows seeding of tau pathology at injection site nine weeks post-injection. AT8 (pSer202/pThr205) tau antibody shows tangle-like inclusions. Experiments performed at reMYND N.V.
Immunohistochemistry analysis of P301L mouse hippocampus injected with K18 P301L tau PFFs shows seeding of tau pathology at injection site nine weeks post-injection. AT8 (pSer202/pThr205) tau antibody shows tangle-like inclusions. Experiments performed at reMYND N.V.

Electron Microscopy

MAPT / Tau Protein - TEM of recombinant Tau (K18), P301L mutant preformed fibrils (PFFs) at 150kx magnification. HV=80kV.
TEM of recombinant Tau (K18), P301L mutant preformed fibrils (PFFs) at 150kx magnification. HV=80kV.

Electron Microscopy

MAPT / Tau Protein - Thioflavin T is a fluorescent dye that binds to beta sheet-rich structures, such as those in tau fibrils. Upon binding, the emission spectrum of the dye experiences a red-shift and increased fluorescence intensity. Thioflavin T emission curves show increased fluorescence (correlated to tau aggregation) over time in tau preformed fibrils. Tau preformed fibrils seed the formation of new tau fibrils when combined with tau monomers. Thioflavin T ex = 450 nm, em = 485 nm.
Thioflavin T is a fluorescent dye that binds to beta sheet-rich structures, such as those in tau fibrils. Upon binding, the emission spectrum of the dye experiences a red-shift and increased fluorescence intensity. Thioflavin T emission curves show increased fluorescence (correlated to tau aggregation) over time in tau preformed fibrils. Tau preformed fibrils seed the formation of new tau fibrils when combined with tau monomers. Thioflavin T ex = 450 nm, em = 485 nm.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

MAPT / Tau Protein - SDS-PAGE of ~15 kDa Active Human Tau Protein K18 P301L Preformed Fibrils. Lane 1: MW Ladder. Lane 2: Tau Protein Preformed Fibrils.
SDS-PAGE of ~15 kDa Active Human Tau Protein K18 P301L Preformed Fibrils. Lane 1: MW Ladder. Lane 2: Tau Protein Preformed Fibrils.

Immunohistochemistry

MAPT / Tau Protein - Immunohistochemistry analysis of P301L mouse hippocampus injected with K18 P301L tau PFFs shows seeding of tau pathology at injection site nine weeks post-injection. AT8 (pSer202/pThr205) tau antibody shows tangle-like inclusions. Experiments performed at reMYND N.V.
Immunohistochemistry analysis of P301L mouse hippocampus injected with K18 P301L tau PFFs shows seeding of tau pathology at injection site nine weeks post-injection. AT8 (pSer202/pThr205) tau antibody shows tangle-like inclusions. Experiments performed at reMYND N.V.

Electron Microscopy

MAPT / Tau Protein - TEM of recombinant Tau (K18), P301L mutant preformed fibrils (PFFs) at 150kx magnification. HV=80kV.
TEM of recombinant Tau (K18), P301L mutant preformed fibrils (PFFs) at 150kx magnification. HV=80kV.

Electron Microscopy

MAPT / Tau Protein - Thioflavin T is a fluorescent dye that binds to beta sheet-rich structures, such as those in tau fibrils. Upon binding, the emission spectrum of the dye experiences a red-shift and increased fluorescence intensity. Thioflavin T emission curves show increased fluorescence (correlated to tau aggregation) over time in tau preformed fibrils. Tau preformed fibrils seed the formation of new tau fibrils when combined with tau monomers. Thioflavin T ex = 450 nm, em = 485 nm.
Thioflavin T is a fluorescent dye that binds to beta sheet-rich structures, such as those in tau fibrils. Upon binding, the emission spectrum of the dye experiences a red-shift and increased fluorescence intensity. Thioflavin T emission curves show increased fluorescence (correlated to tau aggregation) over time in tau preformed fibrils. Tau preformed fibrils seed the formation of new tau fibrils when combined with tau monomers. Thioflavin T ex = 450 nm, em = 485 nm.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

MAPT / Tau Protein - SDS-PAGE of ~15 kDa Active Human Tau Protein K18 P301L Preformed Fibrils. Lane 1: MW Ladder. Lane 2: Tau Protein Preformed Fibrils.
SDS-PAGE of ~15 kDa Active Human Tau Protein K18 P301L Preformed Fibrils. Lane 1: MW Ladder. Lane 2: Tau Protein Preformed Fibrils.

Popular MAPT / Tau Proteins

Product
Rhesus monkey MAPT / Tau Protein (Recombinant His-SUMO) (Full Length) - LS-G20953
Source: E. coli
Tag: His-SUMO
Product
Rat MAPT / Tau Protein (Recombinant His) (Full Length) - LS-G20954
Source: E. coli
Tag: His
MAPT / Tau Protein
Human MAPT / Tau Protein (Recombinant His) - LS-G892
Source: E. coli
Tag: His
Product
Human MAPT / Tau Protein (Recombinant 6His, C-terminus) (Gln249-Gln381) - LS-G38709
Source: E. coli
Tag: 6His, C-terminus
Product
Human MAPT / Tau Protein (Recombinant) (Met1-Leu441) - LS-G39800
Source: E. coli
Tag: None
MAPT / Tau Protein - Recombinant Microtubule Associated Protein Tau By SDS-PAGE
Mouse MAPT / Tau Protein (Recombinant His-T7) (aa92-400) - LS-G14621
Source: E. coli
Tag: His-T7

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com
Requested From: United States
Date Requested: 7/17/2024
Family of Companies
Site Links Home All Antibodies How To Buy All Proteins Distributors All ELISA & Assay Kits Reviews PathPlus™ Antibodies
Follow LSBio View Cart Register or Login
Copyright © 2024 LifeSpan BioSciences, Inc - Privacy Policy
Contact Us

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

To place an order:
Orders@LSBio.com

For questions about orders:
Customer.Support@LSBio.com

For technical assistance:
Technical.Support@LSBio.com