LSBio logo with text
Products
Research Areas
COVID-19
Resources
Contact Us
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Cart
How To Buy
Contact Us

Location

Corporate Headquarters

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Telephone Numbers


Customer Service: (800) 227-6666 / (650) 697-3600


Contact Us


Additional Contact Details

Distributors
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Proteins > HLA-A > LS-G137222
 
Print Page  
Catalog Number Size Price
LS-G137222-20 20 µg $405 
LS-G137222-100 100 µg $598 
LS-G137222-1 1 mg $1,679 
HLA-A Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
HLA-A Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human HLA class I histocompatibility antigen,A-1 alpha chain(HLA-A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HLA-A.
HLA-A Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human HLA class I histocompatibility antigen,A-1 alpha chain(HLA-A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HLA-A.
HLA-A Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
HLA-A Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human HLA class I histocompatibility antigen,A-1 alpha chain(HLA-A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HLA-A.
HLA-A Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human HLA class I histocompatibility antigen,A-1 alpha chain(HLA-A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HLA-A.
1 of 3
2 of 3
3 of 3

Human HLA-A Protein (Recombinant 6His, N-terminus) - LS-G137222

Human HLA-A Protein (Recombinant 6His, N-terminus) - LS-G137222

Submit Review LSBio Guarantee
Description:
HLA-A Protein LS-G137222 is a Recombinant Human HLA-A produced in E. coli 25-308aa with 6His, N-terminus tag(s). For Research Use Only
Price
Catalog Number
$405
LS-G137222-20
Toll Free North America
(800) 227-6666
For Research Use Only
Specifications Publications Reviews Images Popular HLA-A Proteins Request SDS/MSDS

Overview

Description:
HLA-A Protein LS-G137222 is a Recombinant Human HLA-A produced in E. coli 25-308aa with 6His, N-terminus tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
HLA-A
Synonyms
HLA-A | Leukocyte antigen class I-A | HLAA | HLA class I histocompatibility antigen, A-1 alpha chain
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
6His, N-terminus
Region
25-308aa
Predicted Molecular Weight
36.7 kDa
AA Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPI
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 85% by SDS-PAGE
Usage Summary
Involved in the presentation of foreign antigens to the immune system.
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from 10 mM Tris-HCL, 1mM EDTA, 6% Trehalose, pH 8.0
Reconstitution
Briefly centrifuge vial prior to opening. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% of glycerol (final concentration).
Storage
Store lyophilized at -20°C. The reconstituted product can be stored for short term at 4°C or long term at -20°C or below. Avoid freeze/thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About HLA-A
P04439 NM_002116 NP_002107.3

Publications (0)

Submit a Publication for LS-G137222

Customer Reviews (0)

Submit a review for LS-G137222

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

HLA-A Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

HLA-A Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human HLA class I histocompatibility antigen,A-1 alpha chain(HLA-A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HLA-A.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human HLA class I histocompatibility antigen,A-1 alpha chain(HLA-A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HLA-A.

Mass Cytometry

HLA-A Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human HLA class I histocompatibility antigen,A-1 alpha chain(HLA-A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HLA-A.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human HLA class I histocompatibility antigen,A-1 alpha chain(HLA-A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HLA-A.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

HLA-A Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

HLA-A Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human HLA class I histocompatibility antigen,A-1 alpha chain(HLA-A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HLA-A.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human HLA class I histocompatibility antigen,A-1 alpha chain(HLA-A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HLA-A.

Mass Cytometry

HLA-A Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human HLA class I histocompatibility antigen,A-1 alpha chain(HLA-A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HLA-A.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human HLA class I histocompatibility antigen,A-1 alpha chain(HLA-A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HLA-A.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

HLA-A Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

HLA-A Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human HLA class I histocompatibility antigen,A-1 alpha chain(HLA-A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HLA-A.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human HLA class I histocompatibility antigen,A-1 alpha chain(HLA-A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HLA-A.

Mass Cytometry

HLA-A Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human HLA class I histocompatibility antigen,A-1 alpha chain(HLA-A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HLA-A.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human HLA class I histocompatibility antigen,A-1 alpha chain(HLA-A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HLA-A.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

HLA-A Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

HLA-A Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human HLA class I histocompatibility antigen,A-1 alpha chain(HLA-A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HLA-A.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human HLA class I histocompatibility antigen,A-1 alpha chain(HLA-A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HLA-A.

Mass Cytometry

HLA-A Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human HLA class I histocompatibility antigen,A-1 alpha chain(HLA-A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HLA-A.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human HLA class I histocompatibility antigen,A-1 alpha chain(HLA-A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HLA-A.

Popular HLA-A Proteins

HLA-A Protein - 12.5% SDS-PAGE of human HLA-A stained with Coomassie Blue
Human HLA-A Protein (Recombinant GST) (Full Length) - LS-G28832
Source: Wheat
Tag: GST
HLA-A Protein
Human HLA-A Protein (Recombinant His, N-Terminal) (Gly25-Ile308) - LS-G96947
Source: E. coli
Tag: His, N-Terminal
Product
Human HLA-A Protein (Over-Expression Lysate His, N-Terminal) (Gly25-Ile308) - LS-G96949
Source: Human
Tag: His, N-Terminal

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com
Requested From: United States
Date Requested: 12/27/2024
Family of Companies
Site Links Home All Antibodies How To Buy All Proteins Distributors All ELISA & Assay Kits Reviews PathPlus™ Antibodies
Follow LSBio View Cart Register or Login
Copyright © 2024 LifeSpan BioSciences, Inc - Privacy Policy
Contact Us

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Tel: (800) 227-6666 / (650) 697-3600

Orders:
customerservice@vectorlabs.com

For technical assistance:
Technical.Support@LSBio.com