Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Forgot password?
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Quick Order
Products
Antibodies
ELISA and Assay Kits
Research Areas
Infectious Disease
Resources
Purchasing
Reference Material
Contact Us
Location
Corporate Headquarters
Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States
Telephone Numbers
Customer Service: (800) 227-6666 / (650) 697-3600
Contact Us
Additional Contact Details
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Forgot password?
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Quick Order
| Catalog Number | Size | Price |
|---|---|---|
| LS-G136577-20 | 20 µg | $395 |
| LS-G136577-100 | 100 µg | $570 |
| LS-G136577-1 | 1 mg | $1,973 |
1 of 3
2 of 3
3 of 3
Human CD63 Protein (Recombinant 6His, N-terminus) - LS-G136577
Human CD63 Protein (Recombinant 6His, N-terminus) - LS-G136577
Description:
CD63 Protein LS-G136577 is a Recombinant Human CD63 produced in Yeast 103-203aa with 6His, N-terminus tag(s). For Research Use Only
Toll Free North America
(800) 227-6666
(800) 227-6666For Research Use Only
Overview
Description:
CD63 Protein LS-G136577 is a Recombinant Human CD63 produced in Yeast 103-203aa with 6His, N-terminus tag(s). For Research Use Only
Specifications
Type
Recombinant Protein
Target
CD63
Synonyms
CD63 | CD63 molecule | LAMP-3 | ME491 | Granulophysin | MLA1 | Tetraspanin-30 | Tspan-30 | CD63 antigen | OMA81H | TSPAN30
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
6His, N-terminus
Region
103-203aa
Predicted Molecular Weight
13.5 kDa
AA Sequence
AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV
Expression System
Yeast
Source Species
Yeast
Purification
Greater than 85% by SDS-PAGE
Usage Summary
Functions as cell surface receptor for TIMP1 and plays a role in the activation of cellular signaling cascades. Plays a role in the activation of ITGB1 and integrin signaling, leading to the activation of AKT, FAK/PTK2 and MAP kinases. Promotes cell survival, reorganization of the actin cytoskeleton, cell adhesion, spreading and migration, via its role in the activation of AKT and FAK/PTK2. Plays a role in VEGFA signaling via its role in regulating the internalization of KDR/VEGFR2. Plays a role in intracellular vesicular transport processes, and is required for normal trafficking of the PMEL luminal domain that is essential for the development and maturation of melanocytes. Plays a role in the adhesion of leukocytes onto endothelial cells via its role in the regulation of SELP trafficking. May play a role in mast cell degranulation in response to Ms4a2/FceRI stimulation, but not in mast cell degranulation in response to other stimuli.
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
About CD63
Publications (0)
Customer Reviews (0)
Images
Mass Cytometry
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Human CD63 antigen(CD63),partial could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) CD63.
Mass Cytometry
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Human CD63 antigen(CD63),partial could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) CD63.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Human CD63 antigen(CD63),partial could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) CD63.
Mass Cytometry
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Human CD63 antigen(CD63),partial could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) CD63.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Human CD63 antigen(CD63),partial could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) CD63.
Mass Cytometry
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Human CD63 antigen(CD63),partial could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) CD63.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Human CD63 antigen(CD63),partial could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) CD63.
Mass Cytometry
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Human CD63 antigen(CD63),partial could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) CD63.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Popular CD63 Proteins
Source:
E. coli
Tag:
6His, N-terminus
Source:
Human
Tag:
Myc-DDK (Flag)
Request SDS/MSDS
To request an SDS/MSDS form for this product, please contact our Technical Support department at:
Technical.Support@LSBio.com
Requested From: United States
Date Requested: 12/23/2024
Date Requested: 12/23/2024
