Human ZBTB7A / Pokemon

Rabbit

Human, Bovine, Pig, Sheep (tested or 100% immunogen sequence identity)

Polyclonal

Unconjugated

Immunogen affinity purified

Unmodified

A synthetic peptide corresponding to a sequence at the N-Terminus of human ZBTB7A (125-163 aa DLLDRQILAADAGADAGQLDLVDQIDQRNLLRAKEYLEF), different from the related mouse sequence by eleven amino acids, and from the related rat sequence by ten amino acids.

aa125-163

Widely expressed. In normal thymus, expressed in medullary epithelial cells and Hassle's corpuscles (at protein level). In tonsil, expressed in squamous epithelium and germinal center lymphocytes (at protein level). Up-regulated in a subset of lymphomas, as well as in a subset of breast, lung, colon, prostate and bladder carcinomas (at protein level). .

• IHC
• IHC - Paraffin (0.5 - 1 µg/ml)
• Western blot (0.1 - 0.5 µg/ml)

Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.

Add 0.2ml of distilled water will yield a concentration of 500µg/ml.

At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.

For research use only. Intended for use by laboratory professionals.

This antibody carries the LSBio 100% Guarantee.

Uniprot: O95365 NCBI: NM_015898 NP_056982.1