Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Location


Corporate Headquarters

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Telephone Numbers



Customer Service: (800) 227-6666 / (650) 697-3600


Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C331137-20 20 µl $275 
LS-C331137-100 100 µl $389 
XRCC6 / Ku70 Antibody - Immunohistochemistry of paraffin-embedded human stomach using XRCC6 Antibodyat dilution of 1:100 (40x lens).
XRCC6 / Ku70 Antibody - Immunohistochemistry of paraffin-embedded human brain astrocytoma using XRCC6 Antibodyat dilution of 1:100 (40x lens).
XRCC6 / Ku70 Antibody - Immunohistochemistry of paraffin-embedded human adenomyosis using XRCC6 Antibodyat dilution of 1:100 (40x lens).
XRCC6 / Ku70 Antibody - Immunohistochemistry of paraffin-embedded human gastric cancer using XRCC6 Antibodyat dilution of 1:100 (40x lens).
XRCC6 / Ku70 Antibody - Immunohistochemistry of paraffin-embedded rat brain using XRCC6 Antibodyat dilution of 1:100 (40x lens).
XRCC6 / Ku70 Antibody - Immunohistochemistry of paraffin-embedded human breast using XRCC6 Antibodyat dilution of 1:100 (40x lens).
XRCC6 / Ku70 Antibody - Immunohistochemistry of paraffin-embedded human leiomyoma of uterus using XRCC6 Antibodyat dilution of 1:100 (40x lens).
XRCC6 / Ku70 Antibody - Immunohistochemistry of paraffin-embedded human appendicitis using XRCC6 Antibodyat dilution of 1:100 (40x lens).
XRCC6 / Ku70 Antibody - Immunohistochemistry of paraffin-embedded human breast using XRCC6 Antibodyat dilution of 1:100 (40x lens).
XRCC6 / Ku70 Antibody - Immunohistochemistry of paraffin-embedded mouse lung using XRCC6 Antibodyat dilution of 1:100 (40x lens).
XRCC6 / Ku70 Antibody - Immunohistochemistry of paraffin-embedded mouse heart using XRCC6 Antibodyat dilution of 1:100 (40x lens).
XRCC6 / Ku70 Antibody - Immunohistochemistry of paraffin-embedded human breast cancer using XRCC6 Antibodyat dilution of 1:100 (40x lens).
XRCC6 / Ku70 Antibody - Immunohistochemistry of paraffin-embedded human leiomyoma of uterus using XRCC6 Antibodyat dilution of 1:100 (40x lens).
XRCC6 / Ku70 Antibody - Immunohistochemistry of paraffin-embedded human gastric cancer using XRCC6 Antibodyat dilution of 1:100 (40x lens).
XRCC6 / Ku70 Antibody - Immunohistochemistry of paraffin-embedded human stomach using XRCC6 Antibodyat dilution of 1:100 (40x lens).
XRCC6 / Ku70 Antibody - Immunofluorescence analysis of HeLa cells using XRCC6 antibodyat dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
XRCC6 / Ku70 Antibody - Western blot analysis of extracts of various cell lines, using XRCC6 antibody.
XRCC6 / Ku70 Antibody - Western blot analysis of extracts of various cell lines, using XRCC6 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 60s.
XRCC6 / Ku70 Antibody - Immunohistochemistry of paraffin-embedded human stomach using XRCC6 Antibodyat dilution of 1:100 (40x lens).
XRCC6 / Ku70 Antibody - Immunohistochemistry of paraffin-embedded human brain astrocytoma using XRCC6 Antibodyat dilution of 1:100 (40x lens).
XRCC6 / Ku70 Antibody - Immunohistochemistry of paraffin-embedded human adenomyosis using XRCC6 Antibodyat dilution of 1:100 (40x lens).
XRCC6 / Ku70 Antibody - Immunohistochemistry of paraffin-embedded human gastric cancer using XRCC6 Antibodyat dilution of 1:100 (40x lens).
XRCC6 / Ku70 Antibody - Immunohistochemistry of paraffin-embedded rat brain using XRCC6 Antibodyat dilution of 1:100 (40x lens).
XRCC6 / Ku70 Antibody - Immunohistochemistry of paraffin-embedded human breast using XRCC6 Antibodyat dilution of 1:100 (40x lens).
XRCC6 / Ku70 Antibody - Immunohistochemistry of paraffin-embedded human leiomyoma of uterus using XRCC6 Antibodyat dilution of 1:100 (40x lens).
XRCC6 / Ku70 Antibody - Immunohistochemistry of paraffin-embedded human appendicitis using XRCC6 Antibodyat dilution of 1:100 (40x lens).
XRCC6 / Ku70 Antibody - Immunohistochemistry of paraffin-embedded human breast using XRCC6 Antibodyat dilution of 1:100 (40x lens).
XRCC6 / Ku70 Antibody - Immunohistochemistry of paraffin-embedded mouse lung using XRCC6 Antibodyat dilution of 1:100 (40x lens).
XRCC6 / Ku70 Antibody - Immunohistochemistry of paraffin-embedded mouse heart using XRCC6 Antibodyat dilution of 1:100 (40x lens).
XRCC6 / Ku70 Antibody - Immunohistochemistry of paraffin-embedded human breast cancer using XRCC6 Antibodyat dilution of 1:100 (40x lens).
XRCC6 / Ku70 Antibody - Immunohistochemistry of paraffin-embedded human leiomyoma of uterus using XRCC6 Antibodyat dilution of 1:100 (40x lens).
XRCC6 / Ku70 Antibody - Immunohistochemistry of paraffin-embedded human gastric cancer using XRCC6 Antibodyat dilution of 1:100 (40x lens).
XRCC6 / Ku70 Antibody - Immunohistochemistry of paraffin-embedded human stomach using XRCC6 Antibodyat dilution of 1:100 (40x lens).
XRCC6 / Ku70 Antibody - Immunofluorescence analysis of HeLa cells using XRCC6 antibodyat dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
XRCC6 / Ku70 Antibody - Western blot analysis of extracts of various cell lines, using XRCC6 antibody.
XRCC6 / Ku70 Antibody - Western blot analysis of extracts of various cell lines, using XRCC6 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 60s.
1 of 18
2 of 18
3 of 18
4 of 18
5 of 18
6 of 18
7 of 18
8 of 18
9 of 18
10 of 18
11 of 18
12 of 18
13 of 18
14 of 18
15 of 18
16 of 18
17 of 18
18 of 18

Polyclonal Rabbit anti‑Human XRCC6 / Ku70 Antibody (IHC, IF, WB) LS‑C331137

Polyclonal Rabbit anti‑Human XRCC6 / Ku70 Antibody (IHC, IF, WB) LS‑C331137

Antibody:
XRCC6 / Ku70 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB, IP, Flo
Reactivity:
Human, Monkey, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$275
LS-C331137-20
Toll Free North America
(800) 227-6666
For Research Use Only

Overview

Antibody:
XRCC6 / Ku70 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB, IP, Flo
Reactivity:
Human, Monkey, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
Ku70 antibody LS-C331137 is an unconjugated rabbit polyclonal antibody to Ku70 (XRCC6) from human. It is reactive with human, mouse, rat and other species. Validated for Flow, IF, IHC, IP and WB.
Target
Human XRCC6 / Ku70
Synonyms
XRCC6 | 5-dRP lyase Ku70 | 70 kDa subunit of Ku antigen | CTCBF | DNA repair protein XRCC6 | D22S671 | D22S731 | G22P1 | Ku autoantigen, 70kDa | Ku autoantigen p70 subunit | Thyroid-lupus autoantigen p70 | TLAA | CTC75 | KU70 | ML8 | Thyroid-lupus autoantigen
Host
Rabbit
Reactivity
Human, Monkey, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 500-600 of human XRCC6 (NP_001460.1). PEQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYSEEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELL
Specificity
Human XRCC6 / Ku70
Applications
  • IHC (1:50 - 1:200)
  • Immunofluorescence (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
  • Immunoprecipitation (1:20 - 1:50)
  • Flow Cytometry (1:20 - 1:50)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 65kDa/69kDa, while the observed MW by Western blot was 70kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About XRCC6 / Ku70
P12956 NM_001469 NP_001460.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 12/22/2024