Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Location


Corporate Headquarters

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Telephone Numbers



Customer Service: (800) 227-6666 / (650) 697-3600


Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C331598-20 20 µl (0.8 mg/ml) $275 
LS-C331598-100 100 µl (0.804 mg/ml) $389 
S100A4 / FSP1 Antibody - Immunohistochemistry of paraffin-embedded mouse lung using S100A4 antibodyat dilution of 1:100 (40x lens).
S100A4 / FSP1 Antibody - Immunohistochemistry of paraffin-embedded human tonsil using S100A4 antibodyat dilution of 1:100 (40x lens).
S100A4 / FSP1 Antibody - Immunohistochemistry of paraffin-embedded human gastric cancer using S100A4 antibodyat dilution of 1:100 (40x lens).
S100A4 / FSP1 Antibody - Immunohistochemistry of paraffin-embedded rat brain using S100A4 antibodyat dilution of 1:100 (40x lens).
S100A4 / FSP1 Antibody - Immunohistochemistry of paraffin-embedded human mammary gland using S100A4 antibodyat dilution of 1:100 (40x lens).
S100A4 / FSP1 Antibody - Immunofluorescence analysis of PC12 cells using S100A4 antibodyat dilution of 1:100. Blue: DAPI for nuclear staining.
S100A4 / FSP1 Antibody - Immunofluorescence analysis of HeLa cells using S100A4 antibodyat dilution of 1:100. Blue: DAPI for nuclear staining.
S100A4 / FSP1 Antibody - Immunofluorescence analysis of RAW264.7 cells using S100A4 antibodyat dilution of 1:100. Blue: DAPI for nuclear staining.
S100A4 / FSP1 Antibody - Western blot analysis of extracts from normal (control) and S100A4 knockout (KO) HeLa cells, using S100A4 antibodyat 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 180s.
S100A4 / FSP1 Antibody - Western blot analysis of extracts of various cell lines, using S100A4 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
S100A4 / FSP1 Antibody - Western blot analysis of extracts of various cell lines.
S100A4 / FSP1 Antibody - Immunohistochemistry of paraffin-embedded mouse lung using S100A4 antibodyat dilution of 1:100 (40x lens).
S100A4 / FSP1 Antibody - Immunohistochemistry of paraffin-embedded human tonsil using S100A4 antibodyat dilution of 1:100 (40x lens).
S100A4 / FSP1 Antibody - Immunohistochemistry of paraffin-embedded human gastric cancer using S100A4 antibodyat dilution of 1:100 (40x lens).
S100A4 / FSP1 Antibody - Immunohistochemistry of paraffin-embedded rat brain using S100A4 antibodyat dilution of 1:100 (40x lens).
S100A4 / FSP1 Antibody - Immunohistochemistry of paraffin-embedded human mammary gland using S100A4 antibodyat dilution of 1:100 (40x lens).
S100A4 / FSP1 Antibody - Immunofluorescence analysis of PC12 cells using S100A4 antibodyat dilution of 1:100. Blue: DAPI for nuclear staining.
S100A4 / FSP1 Antibody - Immunofluorescence analysis of HeLa cells using S100A4 antibodyat dilution of 1:100. Blue: DAPI for nuclear staining.
S100A4 / FSP1 Antibody - Immunofluorescence analysis of RAW264.7 cells using S100A4 antibodyat dilution of 1:100. Blue: DAPI for nuclear staining.
S100A4 / FSP1 Antibody - Western blot analysis of extracts from normal (control) and S100A4 knockout (KO) HeLa cells, using S100A4 antibodyat 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 180s.
S100A4 / FSP1 Antibody - Western blot analysis of extracts of various cell lines, using S100A4 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
S100A4 / FSP1 Antibody - Western blot analysis of extracts of various cell lines.
1 of 11
2 of 11
3 of 11
4 of 11
5 of 11
6 of 11
7 of 11
8 of 11
9 of 11
10 of 11
11 of 11

Polyclonal Rabbit anti‑Human S100A4 / FSP1 Antibody (IHC, IF, WB) LS‑C331598

Polyclonal Rabbit anti‑Human S100A4 / FSP1 Antibody (IHC, IF, WB) LS‑C331598

Antibody:
S100A4 / FSP1 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$275
LS-C331598-20
Toll Free North America
(800) 227-6666
For Research Use Only

Overview

Antibody:
S100A4 / FSP1 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
FSP1 antibody LS-C331598 is an unconjugated rabbit polyclonal antibody to FSP1 (S100A4) from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.
Target
Human S100A4 / FSP1
Synonyms
S100A4 | 42A | 18A2 | Fibroblast-specific protein-1 | FSP1 | MTS1 | PEL98 | Protein Mts1 | Calvasculin | CAPL | Metastasin | p9KA | Protein S100-A4
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-101 of human S100A4 (NP_002952.1). MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK
Specificity
Human S100A4 / FSP1
Applications
  • IHC (1:50 - 1:200)
  • Immunofluorescence
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 11kDa, while the observed MW by Western blot was 12kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About S100A4 / FSP1
P26447 NM_019554 NP_062427.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 11/22/2024