LSBio logo with text
Products
Research Areas
COVID-19
Resources
Contact Us
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Cart
How To Buy
Contact Us

Location

Corporate Headquarters

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Telephone Numbers


Customer Service: (800) 227-6666 / (650) 697-3600


Contact Us


Additional Contact Details

Distributors
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Antibodies > PPP1R1B / DARPP-32 > LS-C408091
 
Print Page  
Catalog Number Size Price
LS-C408091-10 10 µg $318 
LS-C408091-100 100 µg $470 
PPP1R1B / DARPP-32 Antibody - DARPP32 was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- DARPP32 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.
PPP1R1B / DARPP-32 Antibody - DARPP32 was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- DARPP32 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.
PPP1R1B / DARPP-32 Antibody - DARPP32 was detected in paraffin-embedded sections of mouse pancreas tissues using rabbit anti- DARPP32 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.
PPP1R1B / DARPP-32 Antibody - Western blot analysis of DARPP32 expression in rat brain extract (lane 1), SW620 whole cell lysates (lane 2), 22RV1 whole cell lysates (lane 3) and HELA whole cell lysates (lane 4). DARPP32 at 34 kD, 39 kD was detected using rabbit anti- DARPP32 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.
PPP1R1B / DARPP-32 Antibody - Flow Cytometry analysis of PC-3 cells using anti-DARPP32 antibody. Overlay histogram showing PC-3 cells stained with anti-DARPP32 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-DARPP32 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
PPP1R1B / DARPP-32 Antibody - Flow Cytometry analysis of THP-1 cells using anti-DARPP32 antibody. Overlay histogram showing THP-1 cells stained with anti-DARPP32 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-DARPP32 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
PPP1R1B / DARPP-32 Antibody - DARPP32 was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- DARPP32 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.
PPP1R1B / DARPP-32 Antibody - DARPP32 was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- DARPP32 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.
PPP1R1B / DARPP-32 Antibody - DARPP32 was detected in paraffin-embedded sections of mouse pancreas tissues using rabbit anti- DARPP32 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.
PPP1R1B / DARPP-32 Antibody - Western blot analysis of DARPP32 expression in rat brain extract (lane 1), SW620 whole cell lysates (lane 2), 22RV1 whole cell lysates (lane 3) and HELA whole cell lysates (lane 4). DARPP32 at 34 kD, 39 kD was detected using rabbit anti- DARPP32 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.
PPP1R1B / DARPP-32 Antibody - Flow Cytometry analysis of PC-3 cells using anti-DARPP32 antibody. Overlay histogram showing PC-3 cells stained with anti-DARPP32 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-DARPP32 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
PPP1R1B / DARPP-32 Antibody - Flow Cytometry analysis of THP-1 cells using anti-DARPP32 antibody. Overlay histogram showing THP-1 cells stained with anti-DARPP32 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-DARPP32 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
1 of 6
2 of 6
3 of 6
4 of 6
5 of 6
6 of 6

Polyclonal Rabbit anti‑Human PPP1R1B / DARPP‑32 Antibody (aa1‑36, IHC, WB) LS‑C408091

Polyclonal Rabbit anti‑Human PPP1R1B / DARPP‑32 Antibody (aa1‑36, IHC, WB) LS‑C408091

Submit Review LSBio Guarantee
Antibody:
PPP1R1B / DARPP-32 Rabbit anti-Human Polyclonal (aa1-36) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat, Bovine, Dog, Guinea pig, Hamster, Sheep
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C408091-10
Toll Free North America
(800) 227-6666
For Research Use Only
Specifications Validation Publications Reviews Featured Products Request SDS/MSDS

Overview

Antibody:
PPP1R1B / DARPP-32 Rabbit anti-Human Polyclonal (aa1-36) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat, Bovine, Dog, Guinea pig, Hamster, Sheep
Format:
Unconjugated, Unmodified

Specifications

Description
DARPP-32 antibody LS-C408091 is an unconjugated rabbit polyclonal antibody to DARPP-32 (PPP1R1B) (aa1-36) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
Target
Human PPP1R1B / DARPP-32
Synonyms
PPP1R1B | DARPP-32 | DARPP32
Host
Rabbit
Reactivity
Human, Mouse, Rat, Bovine, Dog, Guinea pig, Hamster, Sheep (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence at the N-Terminus of human DARPP32 (1-36 aa MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPA), identical to the related mouse and rat sequences.
Epitope
aa1-36
Applications
  • IHC
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Presentation
Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About PPP1R1B / DARPP-32
Q9UD71 NM_032192 NP_115568.2

Publications (0)

Submit a Publication for LS-C408091

Customer Reviews (0)

Submit a review for LS-C408091

Featured Products

PPP1R1B / DARPP-32 Antibody - Western blot of rat caudate lysate showing specific immunolabeling of the ~32k DARPP-32 phosphorylated at Thr34 (Control). The phosphospecificity of this labeling is shown in the second lane (lambda-phosphatase: l-Ptase). The blot is identical to the control except that it was incubated in l-Ptase (1200 units for 30 min) before being exposed to the Anti-Thr34 DARPP-32. The immunolabeling is completely eliminated by treatment with l-Ptase.
PPP1R1B / DARPP‑32 Antibody (phospho‑Thr34) LS‑C25
Species: Rat, Human, Mouse, Bovine, Dog, Chicken
Applications: IHC, Western blot
Product
PPP1R1B / DARPP‑32 Antibody (aa51‑204) LS‑C36138
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Western blot, ELISA
PPP1R1B / DARPP-32 Antibody - Western blot of rat caudate lysate showing specific immunolabeling of the ~32k DARPP-32 phosphorylated at Thr75 (Control). The phosphospecificity of this labeling is shown in the second lane (lambda-phosphatase: lambda phosphatase). The blot is identical
PPP1R1B / DARPP‑32 Antibody (phospho‑Thr75) LS‑C27
Species: Rat, Human, Mouse, Bovine, Dog, Chicken
Applications: IHC, Western blot
Product
PPP1R1B / DARPP‑32 Antibody LS‑C22756
Species: Human, Mouse, Rat
Applications: Immunofluorescence, Western blot, ELISA
PPP1R1B / DARPP-32 Antibody - Immunohistochemical analysis of DARPP32 (pT75) staining in human breast cancer formalin fixed paraffin embedded tissue section. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH 6.0). The section was then incubated with the antibody at room temperature and detected using an HRP-conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with hematoxylin and mounted with DPX.
PPP1R1B / DARPP‑32 Antibody (phospho‑Thr75) LS‑C358250
Species: Human, Mouse, Rat, Pig
Applications: IHC, IHC - Paraffin, Western blot
PPP1R1B / DARPP-32 Antibody - Immunohistochemical analysis of DARPP32 (pT34) staining in human breast cancer formalin fixed paraffin embedded tissue section. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH 6.0). The section was then incubated with the antibody at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with hematoxylin and mounted with DPX.
PPP1R1B / DARPP‑32 Antibody (phospho‑Thr34) LS‑C358835
Species: Human, Mouse, Bovine, Pig
Applications: IHC, IHC - Paraffin, ICC, Immunofluorescence, Western blot
See all PPP1R1B / DARPP-32 Antibodies

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com
Requested From: United States
Date Requested: 12/27/2024
Family of Companies
Site Links Home All Antibodies How To Buy All Proteins Distributors All ELISA & Assay Kits Reviews PathPlus™ Antibodies
Follow LSBio View Cart Register or Login
Copyright © 2024 LifeSpan BioSciences, Inc - Privacy Policy
Contact Us

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Tel: (800) 227-6666 / (650) 697-3600

Orders:
customerservice@vectorlabs.com

For technical assistance:
Technical.Support@LSBio.com