LSBio logo with text
Products
Research Areas
COVID-19
Resources
Contact Us
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Cart
How To Buy
Contact Us

Location

Corporate Headquarters

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Telephone Numbers


Customer Service: (800) 227-6666 / (650) 697-3600


Contact Us


Additional Contact Details

Distributors
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Antibodies > PEBP1 / RKIP > LS-C782117
 
Print Page  
Catalog Number Size Price
LS-C782117-100 100 µg $575 
PEBP1 / RKIP Antibody - IHC testing of FFPE human breast cancer with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PEBP1 / RKIP Antibody - IHC testing of FFPE human sarcoma with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PEBP1 / RKIP Antibody - IHC testing of FFPE mouse kidney with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PEBP1 / RKIP Antibody - IHC testing of FFPE human tonsil with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PEBP1 / RKIP Antibody - IHC testing of FFPE human endometrial carcinoma with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PEBP1 / RKIP Antibody - IHC testing of FFPE human pancreatic cancer with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PEBP1 / RKIP Antibody - IHC testing of FFPE mouse brain with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PEBP1 / RKIP Antibody - IHC testing of FFPE human intestinal cancer with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PEBP1 / RKIP Antibody - IHC testing of FFPE human liver cancer with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PEBP1 / RKIP Antibody - Western blot testing of human 1) HeLa, 2) placenta, 3) HepG2, 4) MCF7, 5) mouse testis and 6) mouse brain lysate with RKIP antibody at 0.5ug/ml. Predicted molecular weight ~21 kDa.
PEBP1 / RKIP Antibody - IHC testing of FFPE human breast cancer with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PEBP1 / RKIP Antibody - IHC testing of FFPE human sarcoma with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PEBP1 / RKIP Antibody - IHC testing of FFPE mouse kidney with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PEBP1 / RKIP Antibody - IHC testing of FFPE human tonsil with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PEBP1 / RKIP Antibody - IHC testing of FFPE human endometrial carcinoma with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PEBP1 / RKIP Antibody - IHC testing of FFPE human pancreatic cancer with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PEBP1 / RKIP Antibody - IHC testing of FFPE mouse brain with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PEBP1 / RKIP Antibody - IHC testing of FFPE human intestinal cancer with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PEBP1 / RKIP Antibody - IHC testing of FFPE human liver cancer with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PEBP1 / RKIP Antibody - Western blot testing of human 1) HeLa, 2) placenta, 3) HepG2, 4) MCF7, 5) mouse testis and 6) mouse brain lysate with RKIP antibody at 0.5ug/ml. Predicted molecular weight ~21 kDa.
1 of 10
2 of 10
3 of 10
4 of 10
5 of 10
6 of 10
7 of 10
8 of 10
9 of 10
10 of 10

Polyclonal Rabbit anti‑Human PEBP1 / RKIP Antibody (IHC, WB) LS‑C782117

Polyclonal Rabbit anti‑Human PEBP1 / RKIP Antibody (IHC, WB) LS‑C782117

Submit Review LSBio Guarantee
Antibody:
PEBP1 / RKIP Rabbit anti-Human Polyclonal Antibody
Application:
IHC-P, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified
Price
Catalog Number
$575
LS-C782117-100
Toll Free North America
(800) 227-6666
For Research Use Only
Specifications Validation Publications Reviews Featured Products Request SDS/MSDS

Overview

Antibody:
PEBP1 / RKIP Rabbit anti-Human Polyclonal Antibody
Application:
IHC-P, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified

Specifications

Description
RKIP antibody LS-C782117 is an unconjugated rabbit polyclonal antibody to RKIP (PEBP1) from human. It is reactive with human and mouse. Validated for IHC and WB.
Target
Human PEBP1 / RKIP
Synonyms
PEBP1 | HCNP | HCNPpp | PBP | Prostatic binding protein | Raf kinase inhibitor protein | Raf kinase inhibitory protein | Prostatic-binding protein | Neuropolypeptide h3 | PEBP | PEBP-1 | RKIP
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Antigen Affinity purification
Modifications
Unmodified
Immunogen
Amino acids DHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQ were used as the immunogen for the RKIP antibody.
Applications
  • IHC - Paraffin (1 - 2 µg/ml)
  • Western blot (0.5 - 1 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
Optimal dilution of the RKIP antibody should be determined by the researcher.
Presentation
Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
Reconstitution
Reconstitute with 0.2ml distilled water
Storage
After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About PEBP1 / RKIP
P30086 NM_002567 NP_002558.1

Publications (0)

Submit a Publication for LS-C782117

Customer Reviews (0)

Submit a review for LS-C782117

Featured Products

PEBP1 / RKIP Antibody - Anti-PEBP1 antibody IHC of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
IHC‑plus™ PEBP1 / RKIP Antibody (aa70‑83) LS‑B3247
Species: Human, Monkey, Bovine, Dog, Pig, Rabbit
Applications: IHC, IHC - Paraffin, Western blot, Peptide Enzyme-Linked Immunosorbent Assay
PEBP1 / RKIP Antibody - PBP monoclonal antibody (M01), clone 2G2-1F1. Western Blot analysis of PEBP1 expression in human kidney.
PEBP1 / RKIP Antibody (clone 2G2‑1F1) LS‑C197834
Species: Human
Applications: Western blot
PEBP1 / RKIP Antibody - Formalin-fixed and paraffin-embedded human cancer tissue reacted with the primary antibody, which was peroxidase-conjugated to the secondary antibody, followed by DAB staining. This data demonstrates the use of this antibody for immunohistochemistry; clinical relevance has not been evaluated. BC = breast carcinoma; HC = hepatocarcinoma.
PEBP1 / RKIP Antibody (aa137‑167) LS‑C101192
Species: Human, Mouse
Applications: IHC, IHC - Paraffin, Western blot
PEBP1 / RKIP Antibody - Immunofluorescence analysis of HeLa cells using PEBP1 antibody. Blue: DAPI for nuclear staining.
PEBP1 / RKIP Antibody LS‑C331016
Species: Human, Mouse
Applications: IHC, Immunofluorescence, Western blot, Immunoprecipitation, RNA Immunoprecipitation
PEBP1 / RKIP Antibody - ICC/IF analysis of PEBP1 in HeLa cells line, monoclonal anti-human PEBP1 antibody (1:100) stained with goat anti-mouse IgG-Alexa fluor 488 conjugate (Green).
PEBP1 / RKIP Antibody (clone AT4B11) LS‑C755533
Species: Human
Applications: ICC, Western blot, ELISA
PEBP1 / RKIP Antibody - Immunofluorescent analysis of RKIP staining in HepG2 cells. Formalin-fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 5-10 minutes and blocked with 3% BSA-PBS for 30 minutes at room temperature. Cells were probed with the primary antibody in 3% BSA-PBS and incubated overnight at 4 C in a humidified chamber. Cells were washed with PBST and incubated with a DyLight 594-conjugated secondary antibody (red) in PBS at room temperature in the dark. DAPI was used to stain the cell nuclei (blue).
PEBP1 / RKIP Antibody (Internal) LS‑C352629
Species: Human, Mouse, Rat
Applications: ICC, Immunofluorescence, Western blot
See all PEBP1 / RKIP Antibodies

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com
Requested From: United States
Date Requested: 11/23/2024
Family of Companies
Site Links Home All Antibodies How To Buy All Proteins Distributors All ELISA & Assay Kits Reviews PathPlus™ Antibodies
Follow LSBio View Cart Register or Login
Copyright © 2024 LifeSpan BioSciences, Inc - Privacy Policy
Contact Us

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Tel: (800) 227-6666 / (650) 697-3600

To place an order:
customerservice@vectorlabs.com

For questions about orders:
Customer.Support@LSBio.com

For technical assistance:
Technical.Support@LSBio.com