Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Location


Corporate Headquarters

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Telephone Numbers



Customer Service: (800) 227-6666 / (650) 697-3600


Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C782117-100 100 µg $575 
PEBP1 / RKIP Antibody - IHC testing of FFPE human breast cancer with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PEBP1 / RKIP Antibody - IHC testing of FFPE human sarcoma with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PEBP1 / RKIP Antibody - IHC testing of FFPE mouse kidney with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PEBP1 / RKIP Antibody - IHC testing of FFPE human tonsil with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PEBP1 / RKIP Antibody - IHC testing of FFPE human endometrial carcinoma with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PEBP1 / RKIP Antibody - IHC testing of FFPE human pancreatic cancer with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PEBP1 / RKIP Antibody - IHC testing of FFPE mouse brain with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PEBP1 / RKIP Antibody - IHC testing of FFPE human intestinal cancer with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PEBP1 / RKIP Antibody - IHC testing of FFPE human liver cancer with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PEBP1 / RKIP Antibody - Western blot testing of human 1) HeLa, 2) placenta, 3) HepG2, 4) MCF7, 5) mouse testis and 6) mouse brain lysate with RKIP antibody at 0.5ug/ml. Predicted molecular weight ~21 kDa.
PEBP1 / RKIP Antibody - IHC testing of FFPE human breast cancer with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PEBP1 / RKIP Antibody - IHC testing of FFPE human sarcoma with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PEBP1 / RKIP Antibody - IHC testing of FFPE mouse kidney with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PEBP1 / RKIP Antibody - IHC testing of FFPE human tonsil with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PEBP1 / RKIP Antibody - IHC testing of FFPE human endometrial carcinoma with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PEBP1 / RKIP Antibody - IHC testing of FFPE human pancreatic cancer with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PEBP1 / RKIP Antibody - IHC testing of FFPE mouse brain with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PEBP1 / RKIP Antibody - IHC testing of FFPE human intestinal cancer with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PEBP1 / RKIP Antibody - IHC testing of FFPE human liver cancer with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PEBP1 / RKIP Antibody - Western blot testing of human 1) HeLa, 2) placenta, 3) HepG2, 4) MCF7, 5) mouse testis and 6) mouse brain lysate with RKIP antibody at 0.5ug/ml. Predicted molecular weight ~21 kDa.
1 of 10
2 of 10
3 of 10
4 of 10
5 of 10
6 of 10
7 of 10
8 of 10
9 of 10
10 of 10

Polyclonal Rabbit anti‑Human PEBP1 / RKIP Antibody (IHC, WB) LS‑C782117

Polyclonal Rabbit anti‑Human PEBP1 / RKIP Antibody (IHC, WB) LS‑C782117

Antibody:
PEBP1 / RKIP Rabbit anti-Human Polyclonal Antibody
Application:
IHC-P, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified
Price
Catalog Number
$575
LS-C782117-100
Toll Free North America
(800) 227-6666
For Research Use Only

Overview

Antibody:
PEBP1 / RKIP Rabbit anti-Human Polyclonal Antibody
Application:
IHC-P, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified

Specifications

Description
RKIP antibody LS-C782117 is an unconjugated rabbit polyclonal antibody to RKIP (PEBP1) from human. It is reactive with human and mouse. Validated for IHC and WB.
Target
Human PEBP1 / RKIP
Synonyms
PEBP1 | HCNP | HCNPpp | PBP | Prostatic binding protein | Raf kinase inhibitor protein | Raf kinase inhibitory protein | Prostatic-binding protein | Neuropolypeptide h3 | PEBP | PEBP-1 | RKIP
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Antigen Affinity purification
Modifications
Unmodified
Immunogen
Amino acids DHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQ were used as the immunogen for the RKIP antibody.
Applications
  • IHC - Paraffin (1 - 2 µg/ml)
  • Western blot (0.5 - 1 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
Optimal dilution of the RKIP antibody should be determined by the researcher.
Presentation
Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
Reconstitution
Reconstitute with 0.2ml distilled water
Storage
After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About PEBP1 / RKIP
P30086 NM_002567 NP_002558.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 1/16/2025