Human Neuropeptide Y / NPY

Rabbit

Human, Mouse, Rat, Dog, Guinea pig, Hamster, Rabbit (tested or 100% immunogen sequence identity)

Bovine, Horse, Pig, Sheep, Chicken, Xenopus (at least 90% immunogen sequence identity)

IgG Polyclonal

Unconjugated

Immunoaffinity purified

Unmodified

Synthetic peptide from the middle region of human Neuropeptide Y (YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY, aa29-59 of UniProt P01303). Percent identity by BLAST analysis: Human, Mouse, Rat, Ferret, Cat, Hamster, Rabbit, Guinea pig, Platypus, Dog (100%); Bovine, Elephant, Horse, Pig, Turkey, Zebra finch, Chicken, Lizard, Xenopus (97%); Sheep (94%).

aa29-59

Human Neuropeptide Y / NPY

• IHC
• IHC - Paraffin (0.5 - 1 µg/ml)

Neuropeptide Y is widely expressed in the central nervous system and influences many physiological processes, including cortical excitability, stress response, food intake, circadian rhythms, and cardiovascular function. The neuropeptide functions through G protein-coupled receptors to inhibit adenylyl cyclase, activate mitogen-activated protein kinase (MAPK), regulate intracellular calcium levels, and activate potassium channels. A polymorphism in this gene resulting in a change of leucine 7 to proline in the signal peptide is associated with elevated cholesterol levels, higher alcohol consumption, and may be a risk factor for various metabolic and cardiovascular diseases. Neuropeptide Y also exhibits antimicrobial activity against bacteria and fungi.

Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.

Reconstitute in sterile distilled water.

Prior to reconstitution, 4°C. Following reconstitution store at -20°C. Avoid freeze-thaw cycles.

For research use only. Intended for use by laboratory professionals.

This antibody carries the LSBio 100% Guarantee.

Uniprot: P01303 NCBI: NM_000905 NP_000896.1