LSBio logo with text
Products
Research Areas
COVID-19
Resources
Contact Us
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Cart
How To Buy
Contact Us

Location

Corporate Headquarters

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Telephone Numbers


Customer Service: (800) 227-6666 / (650) 697-3600


Contact Us


Additional Contact Details

Distributors
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Antibodies > IDO1 / IDO > LS-C407816
 
Print Page  
Catalog Number Size Price
LS-C407816-10 10 µg $318 
LS-C407816-100 100 µg $470 
IDO1 / IDO Antibody - IHC analysis of IDO1 using anti-IDO1 antibody. IDO1 was detected in immunocytochemical section of SW480 cell. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-IDO1 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
IDO1 / IDO Antibody - IHC analysis of IDO1 using anti-IDO1 antibody. IDO1 was detected in paraffin-embedded section of Human Lung Cancer Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-IDO1 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
IDO1 / IDO Antibody - IDO1 antibody IHC-paraffin. IHC(P): Human Lung Cancer Tissue.
IDO1 / IDO Antibody - Western blot analysis of IDO1 using anti-IDO1 antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human placenta tissue lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-IDO1 antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for IDO1 at approximately 45KD. The expected band size for IDO1 is at 45KD.
IDO1 / IDO Antibody - IDO1 antibody Western blot. All lanes: Anti IDO1 at 0.5 ug/ml. Lane 1: Rat Lung Tissue Lysate at 50 ug. Lane 2: Rat Spleen Tissue Lysate at 50 ug. Lane 3: Human Placenta Tissue Lysate at 50 ug. Lane 4: A549 Whole Cell Lysate at 40 ug. Lane 5: SW620 Whole Cell Lysate at 40 ug. Lane 6: NIH3T3 Whole Cell Lysate at 40 ug. Predicted band size: 45 kD. Observed band size: 45 kD.
IDO1 / IDO Antibody - Flow Cytometry analysis of A431 cells using anti-IDO1 antibody. Overlay histogram showing A431 cells stained with anti-IDO1 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-IDO1 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
IDO1 / IDO Antibody - IHC analysis of IDO1 using anti-IDO1 antibody. IDO1 was detected in immunocytochemical section of SW480 cell. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-IDO1 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
IDO1 / IDO Antibody - IHC analysis of IDO1 using anti-IDO1 antibody. IDO1 was detected in paraffin-embedded section of Human Lung Cancer Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-IDO1 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
IDO1 / IDO Antibody - IDO1 antibody IHC-paraffin. IHC(P): Human Lung Cancer Tissue.
IDO1 / IDO Antibody - Western blot analysis of IDO1 using anti-IDO1 antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human placenta tissue lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-IDO1 antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for IDO1 at approximately 45KD. The expected band size for IDO1 is at 45KD.
IDO1 / IDO Antibody - IDO1 antibody Western blot. All lanes: Anti IDO1 at 0.5 ug/ml. Lane 1: Rat Lung Tissue Lysate at 50 ug. Lane 2: Rat Spleen Tissue Lysate at 50 ug. Lane 3: Human Placenta Tissue Lysate at 50 ug. Lane 4: A549 Whole Cell Lysate at 40 ug. Lane 5: SW620 Whole Cell Lysate at 40 ug. Lane 6: NIH3T3 Whole Cell Lysate at 40 ug. Predicted band size: 45 kD. Observed band size: 45 kD.
IDO1 / IDO Antibody - Flow Cytometry analysis of A431 cells using anti-IDO1 antibody. Overlay histogram showing A431 cells stained with anti-IDO1 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-IDO1 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
1 of 6
2 of 6
3 of 6
4 of 6
5 of 6
6 of 6

Polyclonal Rabbit anti‑Human IDO1 / IDO Antibody (aa37‑69, IHC, WB) LS‑C407816

Polyclonal Rabbit anti‑Human IDO1 / IDO Antibody (aa37‑69, IHC, WB) LS‑C407816

Submit Review LSBio Guarantee
Antibody:
IDO1 / IDO Rabbit anti-Human Polyclonal (aa37-69) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C407816-10
Toll Free North America
(800) 227-6666
For Research Use Only
Specifications Validation Publications Reviews Featured Products Request SDS/MSDS

Overview

Antibody:
IDO1 / IDO Rabbit anti-Human Polyclonal (aa37-69) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
IDO antibody LS-C407816 is an unconjugated rabbit polyclonal antibody to human IDO (IDO1) (aa37-69). Validated for IHC and WB.
Target
Human IDO1 / IDO
Synonyms
IDO1 | IDO | Indole 2,3-dioxygenase | Indolamine 2,3 dioxygenase | IDO-1 | INDO | Indoleamine 2,3-dioxygenase | Indoleamine 2,3-dioxygenase 1
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence at the N-Terminus of human IDO1 (37-69 aa NDWMFIAKHLPDLIESGQLRERVEKLNMLSIDH), different from the related mouse sequence by fourteen amino acids, and from the related rat sequence by seventeen amino acids.
Epitope
aa37-69
Applications
  • IHC
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
IHC: Antigen retrieval by boiling the paraffin sections in 10 mM citrate buffer, pH6.0, for 20 minutes is required for the staining of formalin/paraffin sections.
Presentation
Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About IDO1 / IDO
P14902 NM_002164 AAA36081.1

Publications (0)

Submit a Publication for LS-C407816

Customer Reviews (0)

Submit a review for LS-C407816

Featured Products

IDO1 / IDO Antibody - Anti-IDO1 / IDO antibody IHC of mouse spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 2.5 ug/ml.
IHC‑plus™ IDO1 / IDO Antibody (aa129‑141) LS‑B1746
Species: Human, Monkey, Mouse
Applications: IHC, IHC - Paraffin, Western blot, Peptide Enzyme-Linked Immunosorbent Assay
IDO1 / IDO Antibody - Anti-IDO1 / IDO antibody IHC of human placenta. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
IHC‑plus™ IDO1 / IDO Antibody (clone 4D2) LS‑B4359
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, ELISA
IDO1 / IDO Antibody - IHC of paraffin-embedded Carcinoma of Human kidney tissue using anti-IDO1 mouse monoclonal antibody.
IDO1 / IDO Antibody (clone OTI2G4) LS‑C174759
Species: Human
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot
IDO1 / IDO Antibody - Immunofluorescence Microscopy of Mouse Anti-IDO1 Antibody. Cells: HEK293 cells. Fixation: 0.5% PFA. Expressing: mouse IDO-1 (left) and mouse IDO-2 (right). Primary antibody: IDO1 (2E2) monoclonal antibody. Antigen retrieval: not required. Secondary antibody: mouse secondary antibody at 1:10000 for 45 min at RT. Localization: IDO-1 is located in the cytosol. Staining: IDO1 as red fluorescent signal with bis-benzimide nuclear counterstain (blue).
IDO1 / IDO Antibody (clone 2E2.6) LS‑C153837
Species: Mouse
Applications: IHC, ICC, Immunofluorescence, Western blot, Flow Cytometry, ELISA
IDO1 / IDO Antibody - Western blot of Mouse Anti-IDO1 Antibody. Lane 1: untreated HeLa cells. Lane 2: IFN-r treated HeLa cells. Load: 35 ug per lane. Primary antibody: IDO 1 Antibody at 1:1000 for overnight at 4C. Secondary antibody: IRDye800 mouse secondary antibody at 1:10000 for 45 min at RT. Block: 5% BLOTTO overnight at 4C. Predicted/Observed size: 41-42 kDa, 41-42 kDa for IDO-1. Other band(s): none.
IDO1 / IDO Antibody (clone 10.1) LS‑C153780
Species: Human, Mouse
Applications: IHC, Immunofluorescence, Western blot, Immunoprecipitation, ELISA
IDO1 / IDO Antibody - IHC of paraffin-embedded Adenocarcinoma of Human endometrium tissue using anti-IDO1 mouse monoclonal antibody.
IDO1 / IDO Antibody (clone OTI1E11) LS‑C174765
Species: Human
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot
See all IDO1 / IDO Antibodies

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com
Requested From: United States
Date Requested: 11/26/2024
Family of Companies
Site Links Home All Antibodies How To Buy All Proteins Distributors All ELISA & Assay Kits Reviews PathPlus™ Antibodies
Follow LSBio View Cart Register or Login
Copyright © 2024 LifeSpan BioSciences, Inc - Privacy Policy
Contact Us

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Tel: (800) 227-6666 / (650) 697-3600

To place an order:
customerservice@vectorlabs.com

For questions about orders:
Customer.Support@LSBio.com

For technical assistance:
Technical.Support@LSBio.com