Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Location


Corporate Headquarters

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Telephone Numbers



Customer Service: (800) 227-6666 / (650) 697-3600


Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C407797-10 10 µg $318 
LS-C407797-100 100 µg $470 
EWSR1 / EWS Antibody - IHC analysis of EWSR1 using anti-EWSR1 antibody. EWSR1 was detected in frozen section of rat intestine tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-EWSR1 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
EWSR1 / EWS Antibody - IHC analysis of EWSR1 using anti-EWSR1 antibody. EWSR1 was detected in frozen section of human placenta tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-EWSR1 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
EWSR1 / EWS Antibody - IHC analysis of EWSR1 using anti-EWSR1 antibody. EWSR1 was detected in immunocytochemical section of human SMMC-7721 cell. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-EWSR1 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
EWSR1 / EWS Antibody - IHC analysis of EWSR1 using anti-EWSR1 antibody. EWSR1 was detected in frozen section of mouse intestine tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-EWSR1 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
EWSR1 / EWS Antibody - EWSR1 antibody IHC-paraffin. IHC(P): Mouse Testis Tissue.
EWSR1 / EWS Antibody - EWSR1 antibody IHC-paraffin. IHC(P): Rat Testis Tissue.
EWSR1 / EWS Antibody - EWSR1 antibody IHC-paraffin. IHC(P): Human Mammary Cancer Tissue.
EWSR1 / EWS Antibody - IF analysis of EWSR1 using anti-EWSR1 antibody EWSR1 was detected in immunocytochemical section of U20S cell. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-EWSR1 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
EWSR1 / EWS Antibody - EWSR1 antibody Western blot. All lanes: Anti EWSR1 at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Rat Testis Tissue Lysate at 50 ug. Lane 3: HELA Whole Cell Lysate at 40 ug. Lane 4: SKOV Whole Cell Lysate at 40 ug. Lane 5: SW620 Whole Cell Lysate at 40 ug. Predicted band size: 68 kD. Observed band size: 95 kD.
EWSR1 / EWS Antibody - Flow Cytometry analysis of U20S cells using anti-EWSR1 antibody. Overlay histogram showing U20S cells stained withanti-EWSR1 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-EWSR1 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
EWSR1 / EWS Antibody - IHC analysis of EWSR1 using anti-EWSR1 antibody. EWSR1 was detected in frozen section of rat intestine tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-EWSR1 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
EWSR1 / EWS Antibody - IHC analysis of EWSR1 using anti-EWSR1 antibody. EWSR1 was detected in frozen section of human placenta tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-EWSR1 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
EWSR1 / EWS Antibody - IHC analysis of EWSR1 using anti-EWSR1 antibody. EWSR1 was detected in immunocytochemical section of human SMMC-7721 cell. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-EWSR1 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
EWSR1 / EWS Antibody - IHC analysis of EWSR1 using anti-EWSR1 antibody. EWSR1 was detected in frozen section of mouse intestine tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-EWSR1 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
EWSR1 / EWS Antibody - EWSR1 antibody IHC-paraffin. IHC(P): Mouse Testis Tissue.
EWSR1 / EWS Antibody - EWSR1 antibody IHC-paraffin. IHC(P): Rat Testis Tissue.
EWSR1 / EWS Antibody - EWSR1 antibody IHC-paraffin. IHC(P): Human Mammary Cancer Tissue.
EWSR1 / EWS Antibody - IF analysis of EWSR1 using anti-EWSR1 antibody EWSR1 was detected in immunocytochemical section of U20S cell. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-EWSR1 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
EWSR1 / EWS Antibody - EWSR1 antibody Western blot. All lanes: Anti EWSR1 at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Rat Testis Tissue Lysate at 50 ug. Lane 3: HELA Whole Cell Lysate at 40 ug. Lane 4: SKOV Whole Cell Lysate at 40 ug. Lane 5: SW620 Whole Cell Lysate at 40 ug. Predicted band size: 68 kD. Observed band size: 95 kD.
EWSR1 / EWS Antibody - Flow Cytometry analysis of U20S cells using anti-EWSR1 antibody. Overlay histogram showing U20S cells stained withanti-EWSR1 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-EWSR1 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
1 of 10
2 of 10
3 of 10
4 of 10
5 of 10
6 of 10
7 of 10
8 of 10
9 of 10
10 of 10

Polyclonal Rabbit anti‑Human EWSR1 / EWS Antibody (aa369‑399, IHC, WB) LS‑C407797

Polyclonal Rabbit anti‑Human EWSR1 / EWS Antibody (aa369‑399, IHC, WB) LS‑C407797

Antibody:
EWSR1 / EWS Rabbit anti-Human Polyclonal (aa369-399) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C407797-10
Toll Free North America
(800) 227-6666
For Research Use Only

Overview

Antibody:
EWSR1 / EWS Rabbit anti-Human Polyclonal (aa369-399) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
EWS antibody LS-C407797 is an unconjugated rabbit polyclonal antibody to EWS (EWSR1) (aa369-399) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Target
Human EWSR1 / EWS
Synonyms
EWSR1 | EWS | RNA-binding protein EWS | BK984G1.4 | EWS oncogene
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human EWSR1 (369-399 aa NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH), different from the related mouse sequence by one amino acid.
Epitope
aa369-399
Specificity
Ubiquitous.
Applications
  • IHC
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
IHC: Antigen retrieval by boiling the paraffin sections in 10 mM citrate buffer, pH6.0, for 20 minutes is required for the staining of formalin/paraffin sections.
Presentation
Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About EWSR1 / EWS
Q01844 NM_005243 NP_005234.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 2/5/2025