Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Location


Corporate Headquarters

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Telephone Numbers



Customer Service: (800) 227-6666 / (650) 697-3600


Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C407695-10 10 µg $318 
LS-C407695-100 100 µg $470 
ATG14 Antibody - ATG14L antibody IHC-paraffin. IHC(P): Human Lung Cancer Tissue.
ATG14 Antibody - ATG14L antibody IHC-paraffin. IHC(P): Rat Spleen Tissue.
ATG14 Antibody - ATG14L antibody Western blot. All lanes: Anti ATG14L at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: HELA Whole Cell Lysate at 40 ug. Predicted band size: 59 kD. Observed band size: 59 kD.
ATG14 Antibody - Flow Cytometry analysis of PC-3 cells using anti-ATG14L antibody. Overlay histogram showing PC-3 cells stained with anti-ATG14L antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-ATG14L Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
ATG14 Antibody - Flow Cytometry analysis of A431 cells using anti-ATG14L antibody. Overlay histogram showing A431 cells stained with anti-ATG14L antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-ATG14L Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
ATG14 Antibody - Flow Cytometry analysis of SiHa cells using anti-ATG14L antibody. Overlay histogram showing SiHa cells stained with anti-ATG14L antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-ATG14L Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
ATG14 Antibody - ATG14L antibody IHC-paraffin. IHC(P): Human Lung Cancer Tissue.
ATG14 Antibody - ATG14L antibody IHC-paraffin. IHC(P): Rat Spleen Tissue.
ATG14 Antibody - ATG14L antibody Western blot. All lanes: Anti ATG14L at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: HELA Whole Cell Lysate at 40 ug. Predicted band size: 59 kD. Observed band size: 59 kD.
ATG14 Antibody - Flow Cytometry analysis of PC-3 cells using anti-ATG14L antibody. Overlay histogram showing PC-3 cells stained with anti-ATG14L antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-ATG14L Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
ATG14 Antibody - Flow Cytometry analysis of A431 cells using anti-ATG14L antibody. Overlay histogram showing A431 cells stained with anti-ATG14L antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-ATG14L Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
ATG14 Antibody - Flow Cytometry analysis of SiHa cells using anti-ATG14L antibody. Overlay histogram showing SiHa cells stained with anti-ATG14L antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-ATG14L Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
1 of 6
2 of 6
3 of 6
4 of 6
5 of 6
6 of 6

Polyclonal Rabbit anti‑Human ATG14 Antibody (aa70‑101, IHC, WB) LS‑C407695

Polyclonal Rabbit anti‑Human ATG14 Antibody (aa70‑101, IHC, WB) LS‑C407695

Antibody:
ATG14 Rabbit anti-Human Polyclonal (aa70-101) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C407695-10
Toll Free North America
(800) 227-6666
For Research Use Only

Overview

Antibody:
ATG14 Rabbit anti-Human Polyclonal (aa70-101) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
ATG14 antibody LS-C407695 is an unconjugated rabbit polyclonal antibody to ATG14 (aa70-101) from human. It is reactive with human and rat. Validated for IHC and WB.
Target
Human ATG14
Synonyms
ATG14 | Autophagy related 14 | Beclin 1-Interacting protein | KIAA0831 | ATG14L | BARKOR
Host
Rabbit
Reactivity
Human, Rat (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence at the N-Terminus of human ATG14L (70-101 aa RDRERFIDKKERLSRLKSKQEEFQKEVLKAME), different from the related mouse and rat sequences by two amino acids.
Epitope
aa70-101
Applications
  • IHC
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
IHC: Antigen retrieval by boiling the paraffin sections in 10 mM citrate buffer, pH6.0, for 20 minutes is required for the staining of formalin/paraffin sections.
Presentation
Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About ATG14
Q6ZNE5 AB020638 BAA74854.2

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 12/22/2024