Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Forgot password?
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Quick Order
Products
Antibodies
ELISA and Assay Kits
Research Areas
Infectious Disease
Resources
Purchasing
Reference Material
Contact Us
Location
Corporate Headquarters
Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States
Telephone Numbers
Customer Service: (800) 227-6666 / (650) 697-3600
Contact Us
Additional Contact Details
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Forgot password?
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Quick Order
| Catalog Number | Size | Price |
|---|---|---|
| LS-G136385-20 | 20 µg | $475 |
| LS-G136385-100 | 100 µg | $1,164 |
| LS-G136385-1 | 1 mg | $2,187 |
1 of 2
2 of 2
Vesicular Stomatitis Virus SARS-CoV Matrix Protein (Recombinant 10His, N-terminus + Myc, C-terminus) (Full Length) - LS-G136385
Vesicular Stomatitis Virus SARS-CoV Matrix Protein (Recombinant 10His, N-terminus + Myc, C-terminus) (Full Length) - LS-G136385
Description:
SARS-CoV Matrix Protein LS-G136385 is a Recombinant Vesicular Stomatitis Virus SARS-CoV Matrix produced in Baculovirus 1-237aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only
Toll Free North America
(800) 227-6666
(800) 227-6666For Research Use Only
Overview
Description:
SARS-CoV Matrix Protein LS-G136385 is a Recombinant Vesicular Stomatitis Virus SARS-CoV Matrix produced in Baculovirus 1-237aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only
Specifications
Type
Recombinant Protein
Target
SARS-CoV Matrix
Synonyms
E1GP-SARS
Species
Vesicular Stomatitis Virus
Modifications
Unmodified
Conjugations
Unconjugated
Tag
10His, N-terminus + Myc, C-terminus
Region
1-237aa
Predicted Molecular Weight
30.7 kDa
AA Sequence
MSSLKKILGLKGKGKKSKKLGIAPPPYEEDTSMEYAPSAPIDKSYFGVDEMDTHDPNQLRYEKSFFTVKMTVRSNRPFRTYSDVAAAVSHWDHMYIGMAGKRPFYKILAFLGSSNLKATPAVLADQGQPEYHAHCEGRAYLPHRMGKTPPMLNVPEHFRRPFNIGLYKGTIELTMTIYDDESLEAAPMIWDHFNSSKFSDFREKALMFGLIVEEEASGAWVLDSVRHSKWASLASSF
Expression System
Baculovirus
Source Species
Baculovirus
Purification
Greater than 85% by SDS-PAGE
Usage Summary
Plays a major role in assembly and budding of virion. Condensates the ribonucleocapsid core during virus assembly. Shut off cellular transcription by inhibiting mRNA nuclear export through direct interaction with host RAE1-NUP98 complex. This shut off presumably inhibit interferon signaling and thus establishment of antiviral state in virus infected cells. Induces cell-rounding, cytoskeleton disorganization and apoptosis in infected cell (By similarity).
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
About SARS-CoV Matrix
Publications (0)
Customer Reviews (0)
Images
Mass Cytometry
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Vesicular stomatitis Indiana virus Matrix protein(M) could indicate that this peptide derived from Baculovirus-expressed Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) DBP.
Mass Cytometry
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Vesicular stomatitis Indiana virus Matrix protein(M) could indicate that this peptide derived from Baculovirus-expressed Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) DBP.
Mass Cytometry
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Vesicular stomatitis Indiana virus Matrix protein(M) could indicate that this peptide derived from Baculovirus-expressed Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) DBP.
Mass Cytometry
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Vesicular stomatitis Indiana virus Matrix protein(M) could indicate that this peptide derived from Baculovirus-expressed Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) DBP.
Mass Cytometry
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Vesicular stomatitis Indiana virus Matrix protein(M) could indicate that this peptide derived from Baculovirus-expressed Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) DBP.
Mass Cytometry
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Vesicular stomatitis Indiana virus Matrix protein(M) could indicate that this peptide derived from Baculovirus-expressed Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) DBP.
Mass Cytometry
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Vesicular stomatitis Indiana virus Matrix protein(M) could indicate that this peptide derived from Baculovirus-expressed Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) DBP.
Mass Cytometry
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Vesicular stomatitis Indiana virus Matrix protein(M) could indicate that this peptide derived from Baculovirus-expressed Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) DBP.
Request SDS/MSDS
To request an SDS/MSDS form for this product, please contact our Technical Support department at:
Technical.Support@LSBio.com
Requested From: United States
Date Requested: 11/24/2024
Date Requested: 11/24/2024
