Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Location


Corporate Headquarters

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Telephone Numbers



Customer Service: (800) 227-6666 / (650) 697-3600


Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G136385-20 20 µg $475 
LS-G136385-100 100 µg $1,164 
LS-G136385-1 1 mg $2,187 
SARS-CoV Matrix Protein - Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Vesicular stomatitis Indiana virus Matrix protein(M) could indicate that this peptide derived from Baculovirus-expressed Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) DBP.
SARS-CoV Matrix Protein - Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Vesicular stomatitis Indiana virus Matrix protein(M) could indicate that this peptide derived from Baculovirus-expressed Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) DBP.
SARS-CoV Matrix Protein - Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Vesicular stomatitis Indiana virus Matrix protein(M) could indicate that this peptide derived from Baculovirus-expressed Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) DBP.
SARS-CoV Matrix Protein - Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Vesicular stomatitis Indiana virus Matrix protein(M) could indicate that this peptide derived from Baculovirus-expressed Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) DBP.
1 of 2
2 of 2

Vesicular Stomatitis Virus SARS-CoV Matrix Protein (Recombinant 10His, N-terminus + Myc, C-terminus) (Full Length) - LS-G136385

Vesicular Stomatitis Virus SARS-CoV Matrix Protein (Recombinant 10His, N-terminus + Myc, C-terminus) (Full Length) - LS-G136385

Description:
SARS-CoV Matrix Protein LS-G136385 is a Recombinant Vesicular Stomatitis Virus SARS-CoV Matrix produced in Baculovirus 1-237aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only
Price
Catalog Number
$475
LS-G136385-20
Toll Free North America
(800) 227-6666
For Research Use Only

Overview

Description:
SARS-CoV Matrix Protein LS-G136385 is a Recombinant Vesicular Stomatitis Virus SARS-CoV Matrix produced in Baculovirus 1-237aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
SARS-CoV Matrix
Synonyms
E1GP-SARS
Species
Vesicular Stomatitis Virus
Modifications
Unmodified
Conjugations
Unconjugated
Tag
10His, N-terminus + Myc, C-terminus
Region
1-237aa
Predicted Molecular Weight
30.7 kDa
AA Sequence
MSSLKKILGLKGKGKKSKKLGIAPPPYEEDTSMEYAPSAPIDKSYFGVDEMDTHDPNQLRYEKSFFTVKMTVRSNRPFRTYSDVAAAVSHWDHMYIGMAGKRPFYKILAFLGSSNLKATPAVLADQGQPEYHAHCEGRAYLPHRMGKTPPMLNVPEHFRRPFNIGLYKGTIELTMTIYDDESLEAAPMIWDHFNSSKFSDFREKALMFGLIVEEEASGAWVLDSVRHSKWASLASSF
Expression System
Baculovirus
Source Species
Baculovirus
Purification
Greater than 85% by SDS-PAGE
Usage Summary
Plays a major role in assembly and budding of virion. Condensates the ribonucleocapsid core during virus assembly. Shut off cellular transcription by inhibiting mRNA nuclear export through direct interaction with host RAE1-NUP98 complex. This shut off presumably inhibit interferon signaling and thus establishment of antiviral state in virus infected cells. Induces cell-rounding, cytoskeleton disorganization and apoptosis in infected cell (By similarity).
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About SARS-CoV Matrix
NP_828855.1

Publications (0)

Customer Reviews (0)

Images

Mass Cytometry

SARS-CoV Matrix Protein - Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Vesicular stomatitis Indiana virus Matrix protein(M) could indicate that this peptide derived from Baculovirus-expressed Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) DBP.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Vesicular stomatitis Indiana virus Matrix protein(M) could indicate that this peptide derived from Baculovirus-expressed Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) DBP.

Mass Cytometry

SARS-CoV Matrix Protein - Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Vesicular stomatitis Indiana virus Matrix protein(M) could indicate that this peptide derived from Baculovirus-expressed Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) DBP.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Vesicular stomatitis Indiana virus Matrix protein(M) could indicate that this peptide derived from Baculovirus-expressed Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) DBP.

Mass Cytometry

SARS-CoV Matrix Protein - Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Vesicular stomatitis Indiana virus Matrix protein(M) could indicate that this peptide derived from Baculovirus-expressed Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) DBP.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Vesicular stomatitis Indiana virus Matrix protein(M) could indicate that this peptide derived from Baculovirus-expressed Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) DBP.

Mass Cytometry

SARS-CoV Matrix Protein - Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Vesicular stomatitis Indiana virus Matrix protein(M) could indicate that this peptide derived from Baculovirus-expressed Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) DBP.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Vesicular stomatitis Indiana virus Matrix protein(M) could indicate that this peptide derived from Baculovirus-expressed Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) DBP.

Mass Cytometry

SARS-CoV Matrix Protein - Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Vesicular stomatitis Indiana virus Matrix protein(M) could indicate that this peptide derived from Baculovirus-expressed Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) DBP.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Vesicular stomatitis Indiana virus Matrix protein(M) could indicate that this peptide derived from Baculovirus-expressed Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) DBP.

Mass Cytometry

SARS-CoV Matrix Protein - Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Vesicular stomatitis Indiana virus Matrix protein(M) could indicate that this peptide derived from Baculovirus-expressed Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) DBP.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Vesicular stomatitis Indiana virus Matrix protein(M) could indicate that this peptide derived from Baculovirus-expressed Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) DBP.

Mass Cytometry

SARS-CoV Matrix Protein - Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Vesicular stomatitis Indiana virus Matrix protein(M) could indicate that this peptide derived from Baculovirus-expressed Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) DBP.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Vesicular stomatitis Indiana virus Matrix protein(M) could indicate that this peptide derived from Baculovirus-expressed Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) DBP.

Mass Cytometry

SARS-CoV Matrix Protein - Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Vesicular stomatitis Indiana virus Matrix protein(M) could indicate that this peptide derived from Baculovirus-expressed Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) DBP.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Vesicular stomatitis Indiana virus Matrix protein(M) could indicate that this peptide derived from Baculovirus-expressed Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) DBP.

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 1/2/2025