Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Location


Corporate Headquarters

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Telephone Numbers



Customer Service: (800) 227-6666 / (650) 697-3600


Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G136865-20 20 µg (3 mg/ml) $475 
LS-G136865-100 100 µg $1,164 
LS-G136865-1 1 mg $2,187 
Smallpox-B5R Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Smallpox-B5R Protein - Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Truncated plaque-size/host range protein(PS/HR) could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain LC16m8) (VACV) PS/HR.
Smallpox-B5R Protein - Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Truncated plaque-size/host range protein(PS/HR) could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain LC16m8) (VACV) PS/HR.
Smallpox-B5R Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Smallpox-B5R Protein - Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Truncated plaque-size/host range protein(PS/HR) could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain LC16m8) (VACV) PS/HR.
Smallpox-B5R Protein - Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Truncated plaque-size/host range protein(PS/HR) could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain LC16m8) (VACV) PS/HR.
1 of 3
2 of 3
3 of 3

Vaccinia Virus Smallpox-B5R Protein (Recombinant MBP, N-terminus + 6His, C-terminus) (Full Length) - LS-G136865

Vaccinia Virus Smallpox-B5R Protein (Recombinant MBP, N-terminus + 6His, C-terminus) (Full Length) - LS-G136865

Description:
Smallpox-B5R Protein LS-G136865 is a Recombinant Vaccinia Virus Smallpox-B5R produced in Baculovirus 18-92aa with MBP, N-terminus + 6His, C-terminus tag(s). For Research Use Only
Price
Catalog Number
$475
LS-G136865-20
Toll Free North America
(800) 227-6666
For Research Use Only

Overview

Description:
Smallpox-B5R Protein LS-G136865 is a Recombinant Vaccinia Virus Smallpox-B5R produced in Baculovirus 18-92aa with MBP, N-terminus + 6His, C-terminus tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
Smallpox-B5R
Synonyms
Variola-B5R
Species
Vaccinia Virus
Modifications
Unmodified
Conjugations
Unconjugated
Tag
MBP, N-terminus + 6His, C-terminus
Region
18-92aa
Predicted Molecular Weight
52.6 kDa
AA Sequence
YSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYK
Expression System
Baculovirus
Source Species
Baculovirus
Purification
Greater than 85% by SDS-PAGE
Usage Summary
Regulation of plaque size and host range. In this strain the truncated ps/hr protein is probably not functional.
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
20mM Tris-HCl, 0.5M NaCl, pH 8.0 and 50% glycerol.
Storage
Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20-80°C for 12 months.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About Smallpox-B5R
P33823 U18341 AAA69447.1

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Smallpox-B5R Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

Smallpox-B5R Protein - Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Truncated plaque-size/host range protein(PS/HR) could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain LC16m8) (VACV) PS/HR.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Truncated plaque-size/host range protein(PS/HR) could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain LC16m8) (VACV) PS/HR.

Mass Cytometry

Smallpox-B5R Protein - Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Truncated plaque-size/host range protein(PS/HR) could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain LC16m8) (VACV) PS/HR.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Truncated plaque-size/host range protein(PS/HR) could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain LC16m8) (VACV) PS/HR.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Smallpox-B5R Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

Smallpox-B5R Protein - Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Truncated plaque-size/host range protein(PS/HR) could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain LC16m8) (VACV) PS/HR.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Truncated plaque-size/host range protein(PS/HR) could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain LC16m8) (VACV) PS/HR.

Mass Cytometry

Smallpox-B5R Protein - Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Truncated plaque-size/host range protein(PS/HR) could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain LC16m8) (VACV) PS/HR.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Truncated plaque-size/host range protein(PS/HR) could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain LC16m8) (VACV) PS/HR.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Smallpox-B5R Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

Smallpox-B5R Protein - Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Truncated plaque-size/host range protein(PS/HR) could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain LC16m8) (VACV) PS/HR.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Truncated plaque-size/host range protein(PS/HR) could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain LC16m8) (VACV) PS/HR.

Mass Cytometry

Smallpox-B5R Protein - Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Truncated plaque-size/host range protein(PS/HR) could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain LC16m8) (VACV) PS/HR.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Truncated plaque-size/host range protein(PS/HR) could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain LC16m8) (VACV) PS/HR.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Smallpox-B5R Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

Smallpox-B5R Protein - Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Truncated plaque-size/host range protein(PS/HR) could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain LC16m8) (VACV) PS/HR.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Truncated plaque-size/host range protein(PS/HR) could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain LC16m8) (VACV) PS/HR.

Mass Cytometry

Smallpox-B5R Protein - Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Truncated plaque-size/host range protein(PS/HR) could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain LC16m8) (VACV) PS/HR.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Truncated plaque-size/host range protein(PS/HR) could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain LC16m8) (VACV) PS/HR.

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 12/19/2024