Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Location


Corporate Headquarters

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Telephone Numbers



Customer Service: (800) 227-6666 / (650) 697-3600


Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G136402-20 20 µg $405 
LS-G136402-100 100 µg $598 
LS-G136402-1 1 mg $1,679 
GAL4 / Galectin 4 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rat Galectin-4(Lgals4) could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Lgals4.
GAL4 / Galectin 4 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rat Galectin-4(Lgals4) could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Lgals4.
GAL4 / Galectin 4 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
GAL4 / Galectin 4 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rat Galectin-4(Lgals4) could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Lgals4.
GAL4 / Galectin 4 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rat Galectin-4(Lgals4) could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Lgals4.
GAL4 / Galectin 4 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
1 of 3
2 of 3
3 of 3

Rat GAL4 / Galectin 4 Protein (Recombinant 6His-SUMO, N-terminus) (Full Length) - LS-G136402

Rat GAL4 / Galectin 4 Protein (Recombinant 6His-SUMO, N-terminus) (Full Length) - LS-G136402

Description:
GAL4 / Galectin 4 Protein LS-G136402 is a Recombinant Rat GAL4 / Galectin 4 produced in E. coli 1-324aa with 6His-SUMO, N-terminus tag(s). For Research Use Only
Price
Catalog Number
$405
LS-G136402-20
Toll Free North America
(800) 227-6666
For Research Use Only

Overview

Description:
GAL4 / Galectin 4 Protein LS-G136402 is a Recombinant Rat GAL4 / Galectin 4 produced in E. coli 1-324aa with 6His-SUMO, N-terminus tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
GAL4 / Galectin 4
Synonyms
LGALS4 | Antigen NY-CO-27 | GAL4 | Galectin 4 | L36LBP | L-36 lactose-binding protein | Gal-4 | Galectin-4 | Lactose-binding lectin 4
Species
Rat
Modifications
Unmodified
Conjugations
Unconjugated
Tag
6His-SUMO, N-terminus
Region
1-324aa
Predicted Molecular Weight
52.3kDa
AA Sequence
MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSIYIQGIAKDNMRRFHVNFAVGQDEGADIAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGHHFELVFMVMSEHYKVVVNGTPFYEYGHRLPLQMVTHLQVDGDLELQSINFLGGQPAASQYPGTMTIPAYPSAGYNPPQMNSLPVMAGPPIFNPPVPYVGTLQGGLTARRTIIIKGYVLPTAKNLIINFKVGSTGDIAFHMNPRIGDCVVRNSYMNGSWGSEERKIPYNPFGAGQFFDLSIRCGTDRFKVFANGQHLFDFSHRFQAFQRVDMLEIKGDITLSYVQI
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 90% by SDS-PAGE
Usage Summary
Galectin that binds lactose and a related range of sugars.
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About GAL4 / Galectin 4
P56470 NM_006149 NP_006140.1

Publications (0)

Customer Reviews (0)

Images

Mass Cytometry

GAL4 / Galectin 4 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rat Galectin-4(Lgals4) could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Lgals4.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rat Galectin-4(Lgals4) could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Lgals4.

Mass Cytometry

GAL4 / Galectin 4 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rat Galectin-4(Lgals4) could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Lgals4.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rat Galectin-4(Lgals4) could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Lgals4.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

GAL4 / Galectin 4 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

GAL4 / Galectin 4 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rat Galectin-4(Lgals4) could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Lgals4.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rat Galectin-4(Lgals4) could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Lgals4.

Mass Cytometry

GAL4 / Galectin 4 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rat Galectin-4(Lgals4) could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Lgals4.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rat Galectin-4(Lgals4) could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Lgals4.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

GAL4 / Galectin 4 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

GAL4 / Galectin 4 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rat Galectin-4(Lgals4) could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Lgals4.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rat Galectin-4(Lgals4) could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Lgals4.

Mass Cytometry

GAL4 / Galectin 4 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rat Galectin-4(Lgals4) could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Lgals4.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rat Galectin-4(Lgals4) could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Lgals4.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

GAL4 / Galectin 4 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

GAL4 / Galectin 4 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rat Galectin-4(Lgals4) could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Lgals4.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rat Galectin-4(Lgals4) could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Lgals4.

Mass Cytometry

GAL4 / Galectin 4 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rat Galectin-4(Lgals4) could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Lgals4.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rat Galectin-4(Lgals4) could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Lgals4.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

GAL4 / Galectin 4 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 4/18/2025