Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Forgot password?
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Quick Order
Products
Antibodies
ELISA and Assay Kits
Research Areas
Infectious Disease
Resources
Purchasing
Reference Material
Contact Us
Location
Corporate Headquarters
Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States
Telephone Numbers
Customer Service: (800) 227-6666 / (650) 697-3600
Contact Us
Additional Contact Details
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Forgot password?
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Quick Order
| Catalog Number | Size | Price |
|---|---|---|
| LS-G136865-20 | 20 µg (3 mg/ml) | $475 |
| LS-G136865-100 | 100 µg | $1,164 |
| LS-G136865-1 | 1 mg | $2,187 |
1 of 3
2 of 3
3 of 3
Vaccinia Virus Smallpox-B5R Protein (Recombinant MBP, N-terminus + 6His, C-terminus) (Full Length) - LS-G136865
Vaccinia Virus Smallpox-B5R Protein (Recombinant MBP, N-terminus + 6His, C-terminus) (Full Length) - LS-G136865
Description:
Smallpox-B5R Protein LS-G136865 is a Recombinant Vaccinia Virus Smallpox-B5R produced in Baculovirus 18-92aa with MBP, N-terminus + 6His, C-terminus tag(s). For Research Use Only
Toll Free North America
(800) 227-6666
(800) 227-6666For Research Use Only
Overview
Description:
Smallpox-B5R Protein LS-G136865 is a Recombinant Vaccinia Virus Smallpox-B5R produced in Baculovirus 18-92aa with MBP, N-terminus + 6His, C-terminus tag(s). For Research Use Only
Specifications
Type
Recombinant Protein
Target
Smallpox-B5R
Synonyms
Variola-B5R
Species
Vaccinia Virus
Modifications
Unmodified
Conjugations
Unconjugated
Tag
MBP, N-terminus + 6His, C-terminus
Region
18-92aa
Predicted Molecular Weight
52.6 kDa
AA Sequence
YSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYK
Expression System
Baculovirus
Source Species
Baculovirus
Purification
Greater than 85% by SDS-PAGE
Usage Summary
Regulation of plaque size and host range. In this strain the truncated ps/hr protein is probably not functional.
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
20mM Tris-HCl, 0.5M NaCl, pH 8.0 and 50% glycerol.
Storage
Avoid repeated freeze/thaw cycles. Store at 4°C for frequent use. Aliquot and store at -20-80°C for 12 months.
Restrictions
For research use only. Intended for use by laboratory professionals.
About Smallpox-B5R
Publications (0)
Customer Reviews (0)
Images
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Truncated plaque-size/host range protein(PS/HR) could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain LC16m8) (VACV) PS/HR.
Mass Cytometry
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Truncated plaque-size/host range protein(PS/HR) could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain LC16m8) (VACV) PS/HR.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Truncated plaque-size/host range protein(PS/HR) could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain LC16m8) (VACV) PS/HR.
Mass Cytometry
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Truncated plaque-size/host range protein(PS/HR) could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain LC16m8) (VACV) PS/HR.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Truncated plaque-size/host range protein(PS/HR) could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain LC16m8) (VACV) PS/HR.
Mass Cytometry
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Truncated plaque-size/host range protein(PS/HR) could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain LC16m8) (VACV) PS/HR.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Truncated plaque-size/host range protein(PS/HR) could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain LC16m8) (VACV) PS/HR.
Mass Cytometry
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Truncated plaque-size/host range protein(PS/HR) could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain LC16m8) (VACV) PS/HR.
Popular Smallpox-B5R Proteins
Source:
E. coli
Tag:
6His, N-terminus
Source:
Yeast
Tag:
6His, N-terminus
Request SDS/MSDS
To request an SDS/MSDS form for this product, please contact our Technical Support department at:
Technical.Support@LSBio.com
Requested From: United States
Date Requested: 12/20/2024
Date Requested: 12/20/2024
