Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Forgot password?
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Quick Order
Products
Antibodies
ELISA and Assay Kits
Research Areas
Infectious Disease
Resources
Purchasing
Reference Material
Contact Us
Location
Corporate Headquarters
Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States
Telephone Numbers
Customer Service: (800) 227-6666 / (650) 697-3600
Contact Us
Additional Contact Details
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Forgot password?
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Quick Order
| Catalog Number | Size | Price |
|---|---|---|
| LS-G136539-20 | 20 µg | $405 |
| LS-G136539-100 | 100 µg | $598 |
| LS-G136539-1 | 1 mg | $1,679 |
1 of 3
2 of 3
3 of 3
Pig GOB5 / CLCA1 Protein (Recombinant 10His, N-terminus + Myc, C-terminus) - LS-G136539
Pig GOB5 / CLCA1 Protein (Recombinant 10His, N-terminus + Myc, C-terminus) - LS-G136539
Description:
GOB5 / CLCA1 Protein LS-G136539 is a Recombinant Pig GOB5 / CLCA1 produced in E. coli 46-199aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only
Toll Free North America
(800) 227-6666
(800) 227-6666For Research Use Only
Overview
Description:
GOB5 / CLCA1 Protein LS-G136539 is a Recombinant Pig GOB5 / CLCA1 produced in E. coli 46-199aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only
Specifications
Type
Recombinant Protein
Target
GOB5 / CLCA1
Synonyms
CLCA1 | CaCC-1 | CLCRG1 | HCLCA1 | HCaCC-1 | GOB5 | CaCC | CACC1 | Chloride channel accessory 1 | Chloride channel regulator 1
Species
Pig
Modifications
Unmodified
Conjugations
Unconjugated
Tag
10His, N-terminus + Myc, C-terminus
Region
46-199aa
Predicted Molecular Weight
22.8 kDa
AA Sequence
DERLIQNIKDMVTKASPYLFEATEKRFYFKNVAILIPASWKAKPEYVKPKLETYKNADVVVTEPNPPENDGPYTEQMGNCGEKGEKIYFTPDFVAGKKVLQYGPQGRVFVHEWAHLRWGVFNEYNNEQKFYLSNKKEQPVICSAAIRGTNVLPQ
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 85% by SDS-PAGE
Usage Summary
May be involved in mediating calcium-activated chloride conductance. May play critical roles in goblet cell metaplasia, mucus hypersecretion, cystic fibrosis and AHR. May be involved in the regulation of mucus production and/or secretion by goblet cells. Involved in the regulation of tissue inflammation in the innate immune response. May play a role as a tumor suppressor. Induces MUC5AC. Induces a cAMP-dependent chloride conductance possibly through effects on CFTR in colon carcinoma cells.
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
About GOB5 / CLCA1
Publications (0)
Customer Reviews (0)
Images
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Calcium-activated chloride channel regulator 1(CLCA1),partial could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) CLCA1.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Calcium-activated chloride channel regulator 1(CLCA1),partial could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) CLCA1.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Calcium-activated chloride channel regulator 1(CLCA1),partial could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) CLCA1.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Calcium-activated chloride channel regulator 1(CLCA1),partial could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) CLCA1.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Calcium-activated chloride channel regulator 1(CLCA1),partial could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) CLCA1.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Calcium-activated chloride channel regulator 1(CLCA1),partial could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) CLCA1.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Calcium-activated chloride channel regulator 1(CLCA1),partial could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) CLCA1.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Calcium-activated chloride channel regulator 1(CLCA1),partial could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) CLCA1.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Popular GOB5 / CLCA1 Proteins
Source:
E. coli
Tag:
His, N-Terminal
Request SDS/MSDS
To request an SDS/MSDS form for this product, please contact our Technical Support department at:
Technical.Support@LSBio.com
Requested From: United States
Date Requested: 11/29/2024
Date Requested: 11/29/2024
