LSBio logo with text
Products
Research Areas
COVID-19
Resources
Contact Us
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Cart
How To Buy
Contact Us

Locations

Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers


Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us


Additional Contact Details

Distributors
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Proteins > GOB5 / CLCA1 > LS-G136539
 
Print Page  
Catalog Number Size Price
LS-G136539-20 20 µg $405 
LS-G136539-100 100 µg $598 
LS-G136539-1 1 mg $1,679 
GOB5 / CLCA1 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Calcium-activated chloride channel regulator 1(CLCA1),partial could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) CLCA1.
GOB5 / CLCA1 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Calcium-activated chloride channel regulator 1(CLCA1),partial could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) CLCA1.
GOB5 / CLCA1 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
GOB5 / CLCA1 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Calcium-activated chloride channel regulator 1(CLCA1),partial could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) CLCA1.
GOB5 / CLCA1 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Calcium-activated chloride channel regulator 1(CLCA1),partial could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) CLCA1.
GOB5 / CLCA1 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
1 of 3
2 of 3
3 of 3

Pig GOB5 / CLCA1 Protein (Recombinant 10His, N-terminus + Myc, C-terminus) - LS-G136539

Pig GOB5 / CLCA1 Protein (Recombinant 10His, N-terminus + Myc, C-terminus) - LS-G136539

Submit Review LSBio Guarantee
Description:
GOB5 / CLCA1 Protein LS-G136539 is a Recombinant Pig GOB5 / CLCA1 produced in E. coli 46-199aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only
Price
Catalog Number
$405
LS-G136539-20
Toll Free North America
206-374-1102
For Research Use Only
Specifications Publications Reviews Images Popular GOB5 / CLCA1 Proteins Request SDS/MSDS

Overview

Description:
GOB5 / CLCA1 Protein LS-G136539 is a Recombinant Pig GOB5 / CLCA1 produced in E. coli 46-199aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
GOB5 / CLCA1
Synonyms
CLCA1 | CaCC-1 | CLCRG1 | HCLCA1 | HCaCC-1 | GOB5 | CaCC | CACC1 | Chloride channel accessory 1 | Chloride channel regulator 1
Species
Pig
Modifications
Unmodified
Conjugations
Unconjugated
Tag
10His, N-terminus + Myc, C-terminus
Region
46-199aa
Predicted Molecular Weight
22.8 kDa
AA Sequence
DERLIQNIKDMVTKASPYLFEATEKRFYFKNVAILIPASWKAKPEYVKPKLETYKNADVVVTEPNPPENDGPYTEQMGNCGEKGEKIYFTPDFVAGKKVLQYGPQGRVFVHEWAHLRWGVFNEYNNEQKFYLSNKKEQPVICSAAIRGTNVLPQ
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 85% by SDS-PAGE
Usage Summary
May be involved in mediating calcium-activated chloride conductance. May play critical roles in goblet cell metaplasia, mucus hypersecretion, cystic fibrosis and AHR. May be involved in the regulation of mucus production and/or secretion by goblet cells. Involved in the regulation of tissue inflammation in the innate immune response. May play a role as a tumor suppressor. Induces MUC5AC. Induces a cAMP-dependent chloride conductance possibly through effects on CFTR in colon carcinoma cells.
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About GOB5 / CLCA1
A8K7I4 NM_001285 NP_001276.2

Publications (0)

Submit a Publication for LS-G136539

Customer Reviews (0)

Submit a review for LS-G136539

Images

Mass Cytometry

GOB5 / CLCA1 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Calcium-activated chloride channel regulator 1(CLCA1),partial could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) CLCA1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Calcium-activated chloride channel regulator 1(CLCA1),partial could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) CLCA1.

Mass Cytometry

GOB5 / CLCA1 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Calcium-activated chloride channel regulator 1(CLCA1),partial could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) CLCA1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Calcium-activated chloride channel regulator 1(CLCA1),partial could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) CLCA1.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

GOB5 / CLCA1 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

GOB5 / CLCA1 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Calcium-activated chloride channel regulator 1(CLCA1),partial could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) CLCA1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Calcium-activated chloride channel regulator 1(CLCA1),partial could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) CLCA1.

Mass Cytometry

GOB5 / CLCA1 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Calcium-activated chloride channel regulator 1(CLCA1),partial could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) CLCA1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Calcium-activated chloride channel regulator 1(CLCA1),partial could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) CLCA1.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

GOB5 / CLCA1 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

GOB5 / CLCA1 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Calcium-activated chloride channel regulator 1(CLCA1),partial could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) CLCA1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Calcium-activated chloride channel regulator 1(CLCA1),partial could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) CLCA1.

Mass Cytometry

GOB5 / CLCA1 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Calcium-activated chloride channel regulator 1(CLCA1),partial could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) CLCA1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Calcium-activated chloride channel regulator 1(CLCA1),partial could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) CLCA1.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

GOB5 / CLCA1 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

GOB5 / CLCA1 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Calcium-activated chloride channel regulator 1(CLCA1),partial could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) CLCA1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Calcium-activated chloride channel regulator 1(CLCA1),partial could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) CLCA1.

Mass Cytometry

GOB5 / CLCA1 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Calcium-activated chloride channel regulator 1(CLCA1),partial could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) CLCA1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Calcium-activated chloride channel regulator 1(CLCA1),partial could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) CLCA1.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

GOB5 / CLCA1 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Popular GOB5 / CLCA1 Proteins

GOB5 / CLCA1 Protein - Active Chloride Channel Accessory 1 (CLCA1) by WB
Human GOB5 / CLCA1 Protein (Recombinant His, N-Terminal) (aa416-670) - LS-G133749
Source: E. coli
Tag: His, N-Terminal

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com
Requested From: United States
Date Requested: 10/19/2024
Family of Companies
Site Links Home All Antibodies How To Buy All Proteins Distributors All ELISA & Assay Kits Reviews PathPlus™ Antibodies
Follow LSBio View Cart Register or Login
Copyright © 2024 LifeSpan BioSciences, Inc - Privacy Policy
Contact Us

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

To place an order:
Orders@LSBio.com

For questions about orders:
Customer.Support@LSBio.com

For technical assistance:
Technical.Support@LSBio.com