Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G137026-20 20 µg $364 
LS-G137026-100 100 µg $500 
LS-G137026-1 1 mg $1,679 
GH / Growth Hormone Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
GH / Growth Hormone Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Somatotropin(GH1) could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) GH1.
GH / Growth Hormone Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Somatotropin(GH1) could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) GH1.
GH / Growth Hormone Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
GH / Growth Hormone Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Somatotropin(GH1) could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) GH1.
GH / Growth Hormone Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Somatotropin(GH1) could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) GH1.
1 of 3
2 of 3
3 of 3

Pig GH / Growth Hormone Protein (Recombinant 10His, N-terminus + Myc, C-terminus) (Full Length) - LS-G137026

Pig GH / Growth Hormone Protein (Recombinant 10His, N-terminus + Myc, C-terminus) (Full Length) - LS-G137026

Description:
GH / Growth Hormone Protein LS-G137026 is a Recombinant Pig GH / Growth Hormone produced in E. coli 1-216aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only
Price
Catalog Number
$364
LS-G137026-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
GH / Growth Hormone Protein LS-G137026 is a Recombinant Pig GH / Growth Hormone produced in E. coli 1-216aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
GH / Growth Hormone
Synonyms
GH1 | Growth hormone | GH | GHN | IGHD1B | GH-N | Pituitary growth hormone | Growth hormone 1 | Somatotropin
Species
Pig
Modifications
Unmodified
Conjugations
Unconjugated
Tag
10His, N-terminus + Myc, C-terminus
Region
1-216aa
Predicted Molecular Weight
29.4 kDa
AA Sequence
MAAGPRTSALLAFALLCLPWTREVGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKDLEEGIQALMRELEDGSPRAGQILKQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 85% by SDS-PAGE
Usage Summary
Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues.
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About GH / Growth Hormone
P01241 NM_000515 NP_000506.2

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

GH / Growth Hormone Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

GH / Growth Hormone Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Somatotropin(GH1) could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) GH1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Somatotropin(GH1) could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) GH1.

Mass Cytometry

GH / Growth Hormone Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Somatotropin(GH1) could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) GH1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Somatotropin(GH1) could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) GH1.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

GH / Growth Hormone Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

GH / Growth Hormone Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Somatotropin(GH1) could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) GH1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Somatotropin(GH1) could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) GH1.

Mass Cytometry

GH / Growth Hormone Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Somatotropin(GH1) could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) GH1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Somatotropin(GH1) could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) GH1.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

GH / Growth Hormone Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

GH / Growth Hormone Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Somatotropin(GH1) could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) GH1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Somatotropin(GH1) could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) GH1.

Mass Cytometry

GH / Growth Hormone Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Somatotropin(GH1) could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) GH1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Somatotropin(GH1) could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) GH1.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

GH / Growth Hormone Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

GH / Growth Hormone Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Somatotropin(GH1) could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) GH1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Somatotropin(GH1) could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) GH1.

Mass Cytometry

GH / Growth Hormone Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Somatotropin(GH1) could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) GH1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Pig Somatotropin(GH1) could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) GH1.

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 5/18/2024