Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Location


Corporate Headquarters

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Telephone Numbers



Customer Service: (800) 227-6666 / (650) 697-3600


Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G136462-20 20 µg $405 
LS-G136462-100 100 µg $598 
LS-G136462-1 1 mg $1,679 
VCAN / Versican Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Versican core protein(Vcan),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Vcan.
VCAN / Versican Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Versican core protein(Vcan),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Vcan.
VCAN / Versican Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Versican core protein(Vcan),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Vcan.
VCAN / Versican Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Versican core protein(Vcan),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Vcan.
1 of 2
2 of 2

Mouse VCAN / Versican Protein (Recombinant 10His, N-terminus + Myc, C-terminus) - LS-G136462

Mouse VCAN / Versican Protein (Recombinant 10His, N-terminus + Myc, C-terminus) - LS-G136462

Description:
VCAN / Versican Protein LS-G136462 is a Recombinant Mouse VCAN / Versican produced in E. coli 24-146aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only
Price
Catalog Number
$405
LS-G136462-20
Toll Free North America
(800) 227-6666
For Research Use Only

Overview

Description:
VCAN / Versican Protein LS-G136462 is a Recombinant Mouse VCAN / Versican produced in E. coli 24-146aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
VCAN / Versican
Synonyms
VCAN | CSPG2 | ERVR | GHAP | Large fibroblast proteoglycan | PG-M | Versican | WGN | Versican core protein | Versican proteoglycan | WGN1
Species
Mouse
Modifications
Unmodified
Conjugations
Unconjugated
Tag
10His, N-terminus + Myc, C-terminus
Region
24-146aa
Predicted Molecular Weight
20.9 kDa
AA Sequence
AKMETSPPVKGSLSGKVVLPCHFSTLPTLPPNYNTSEFLRIKWSKMEVDKNGKDIKETTVLVAQNGNIKIGQDYKGRVSVPTHPDDVGDASLTMVKLRASDAAVYRCDVMYGIEDTQDTMSLA
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 85% by SDS-PAGE
Usage Summary
May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid.
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About VCAN / Versican
P13611 NM_004385 NP_004376.2

Publications (0)

Customer Reviews (0)

Images

Mass Cytometry

VCAN / Versican Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Versican core protein(Vcan),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Vcan.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Versican core protein(Vcan),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Vcan.

Mass Cytometry

VCAN / Versican Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Versican core protein(Vcan),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Vcan.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Versican core protein(Vcan),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Vcan.

Mass Cytometry

VCAN / Versican Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Versican core protein(Vcan),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Vcan.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Versican core protein(Vcan),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Vcan.

Mass Cytometry

VCAN / Versican Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Versican core protein(Vcan),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Vcan.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Versican core protein(Vcan),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Vcan.

Mass Cytometry

VCAN / Versican Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Versican core protein(Vcan),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Vcan.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Versican core protein(Vcan),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Vcan.

Mass Cytometry

VCAN / Versican Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Versican core protein(Vcan),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Vcan.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Versican core protein(Vcan),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Vcan.

Mass Cytometry

VCAN / Versican Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Versican core protein(Vcan),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Vcan.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Versican core protein(Vcan),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Vcan.

Mass Cytometry

VCAN / Versican Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Versican core protein(Vcan),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Vcan.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Versican core protein(Vcan),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Vcan.

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 2/3/2025