Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Location


Corporate Headquarters

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Telephone Numbers



Customer Service: (800) 227-6666 / (650) 697-3600


Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G136517-20 20 µg $405 
LS-G136517-100 100 µg $598 
LS-G136517-1 1 mg $1,679 
UPK3A / UPK3 / Uroplakin III Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Uroplakin-3a(Upk3a),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Upk3a.
UPK3A / UPK3 / Uroplakin III Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Uroplakin-3a(Upk3a),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Upk3a.
UPK3A / UPK3 / Uroplakin III Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
UPK3A / UPK3 / Uroplakin III Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Uroplakin-3a(Upk3a),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Upk3a.
UPK3A / UPK3 / Uroplakin III Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Uroplakin-3a(Upk3a),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Upk3a.
UPK3A / UPK3 / Uroplakin III Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
1 of 3
2 of 3
3 of 3

Mouse UPK3A / UPK3 / Uroplakin III Protein (Recombinant 10His, N-terminus + Myc, C-terminus) - LS-G136517

Mouse UPK3A / UPK3 / Uroplakin III Protein (Recombinant 10His, N-terminus + Myc, C-terminus) - LS-G136517

Description:
UPK3A / UPK3 / Uroplakin III Protein LS-G136517 is a Recombinant Mouse UPK3A / UPK3 / Uroplakin III produced in E. coli 19-207aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only
Price
Catalog Number
$405
LS-G136517-20
Toll Free North America
(800) 227-6666
For Research Use Only

Overview

Description:
UPK3A / UPK3 / Uroplakin III Protein LS-G136517 is a Recombinant Mouse UPK3A / UPK3 / Uroplakin III produced in E. coli 19-207aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
UPK3A / UPK3 / Uroplakin III
Synonyms
UPK3A | Uroplakin 3 | Uroplakin 3A | Uroplakin III | UPIII | UP3A | UPIIIA | UPK3 | Uroplakin-3a
Species
Mouse
Modifications
Unmodified
Conjugations
Unconjugated
Tag
10His, N-terminus + Myc, C-terminus
Region
19-207aa
Predicted Molecular Weight
25.5 kDa
AA Sequence
VNLQPQLASVTFATNNPTLTTVALEKPLCMFDSSEPLSGSYEVYLYAMVDSAMSRNVSVQDSAGVPLSTTFRQTQGGRSGPYKAAAFDLTPCGDLPSLDAVGDVTQASEILNAYLVRVGNNGTCFWDPNFQGLCNPPLTAATEYRFKYVLVNMSTGLVQDQTLWSDPIWTNRPIPYSAIDTWPGRRSGG
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 85% by SDS-PAGE
Usage Summary
Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in AUM-cytoskeleton interaction in terminally differentiated urothelial cells. It also contributes to the formation of urothelial glycocalyx which may play an important role in preventing bacterial adherence (By similarity).
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About UPK3A / UPK3 / Uroplakin III
O75631 NM_006953 NP_008884.1

Publications (0)

Customer Reviews (0)

Images

Mass Cytometry

UPK3A / UPK3 / Uroplakin III Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Uroplakin-3a(Upk3a),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Upk3a.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Uroplakin-3a(Upk3a),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Upk3a.

Mass Cytometry

UPK3A / UPK3 / Uroplakin III Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Uroplakin-3a(Upk3a),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Upk3a.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Uroplakin-3a(Upk3a),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Upk3a.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

UPK3A / UPK3 / Uroplakin III Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

UPK3A / UPK3 / Uroplakin III Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Uroplakin-3a(Upk3a),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Upk3a.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Uroplakin-3a(Upk3a),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Upk3a.

Mass Cytometry

UPK3A / UPK3 / Uroplakin III Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Uroplakin-3a(Upk3a),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Upk3a.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Uroplakin-3a(Upk3a),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Upk3a.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

UPK3A / UPK3 / Uroplakin III Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

UPK3A / UPK3 / Uroplakin III Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Uroplakin-3a(Upk3a),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Upk3a.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Uroplakin-3a(Upk3a),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Upk3a.

Mass Cytometry

UPK3A / UPK3 / Uroplakin III Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Uroplakin-3a(Upk3a),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Upk3a.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Uroplakin-3a(Upk3a),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Upk3a.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

UPK3A / UPK3 / Uroplakin III Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

UPK3A / UPK3 / Uroplakin III Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Uroplakin-3a(Upk3a),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Upk3a.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Uroplakin-3a(Upk3a),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Upk3a.

Mass Cytometry

UPK3A / UPK3 / Uroplakin III Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Uroplakin-3a(Upk3a),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Upk3a.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Uroplakin-3a(Upk3a),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Upk3a.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

UPK3A / UPK3 / Uroplakin III Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 11/22/2024