Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Location


Corporate Headquarters

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Telephone Numbers



Customer Service: (800) 227-6666 / (650) 697-3600


Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G136982-20 20 µg $405 
LS-G136982-100 100 µg $598 
LS-G136982-1 1 mg $1,679 
CIRP / CIRBP Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
CIRP / CIRBP Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cold-inducible RNA-binding protein(Cirbp) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cirbp.
CIRP / CIRBP Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cold-inducible RNA-binding protein(Cirbp) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cirbp.
CIRP / CIRBP Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
CIRP / CIRBP Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cold-inducible RNA-binding protein(Cirbp) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cirbp.
CIRP / CIRBP Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cold-inducible RNA-binding protein(Cirbp) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cirbp.
1 of 3
2 of 3
3 of 3

Mouse CIRP / CIRBP Protein (Recombinant 6His, N-terminus) (Full Length) - LS-G136982

Mouse CIRP / CIRBP Protein (Recombinant 6His, N-terminus) (Full Length) - LS-G136982

Description:
CIRP / CIRBP Protein LS-G136982 is a Recombinant Mouse CIRP / CIRBP produced in E. coli 1-172aa with 6His, N-terminus tag(s). For Research Use Only
Price
Catalog Number
$405
LS-G136982-20
Toll Free North America
(800) 227-6666
For Research Use Only

Overview

Description:
CIRP / CIRBP Protein LS-G136982 is a Recombinant Mouse CIRP / CIRBP produced in E. coli 1-172aa with 6His, N-terminus tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
CIRP / CIRBP
Synonyms
CIRBP | A18 hnRNP | A18HNRNP | CIRP
Species
Mouse
Modifications
Unmodified
Conjugations
Unconjugated
Tag
6His, N-terminus
Region
1-172aa
Predicted Molecular Weight
22.6 kDa
AA Sequence
MASDEGKLFVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRSRGRGFSRGGGDRGYGGGRFESRSGGYGGSRDYYASRSQGGSYGYRSSGGSYRDSYDSYATHNE
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 90% by SDS-PAGE
Usage Summary
Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Promotes assembly of stress granules (SGs), when overexpressed. Seems to play an essential role in cold-induced suppression of cell proliferation. Acts as a translational repressor. Acts as a translational activator. Binds specifically to the 3'-untranslated regions (3'-UTRs) of stress-responsive transcripts RPA2 and TXN.
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
10 mM Tris-HCL, 1mM EDTA, 6% Trehalose, pH 8.0
Reconstitution
Briefly centrifuge vial prior to opening. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% of glycerol (final concentration).
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About CIRP / CIRBP
Q14011 NM_001280 NP_001271.1

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

CIRP / CIRBP Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

CIRP / CIRBP Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cold-inducible RNA-binding protein(Cirbp) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cirbp.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cold-inducible RNA-binding protein(Cirbp) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cirbp.

Mass Cytometry

CIRP / CIRBP Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cold-inducible RNA-binding protein(Cirbp) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cirbp.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cold-inducible RNA-binding protein(Cirbp) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cirbp.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

CIRP / CIRBP Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

CIRP / CIRBP Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cold-inducible RNA-binding protein(Cirbp) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cirbp.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cold-inducible RNA-binding protein(Cirbp) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cirbp.

Mass Cytometry

CIRP / CIRBP Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cold-inducible RNA-binding protein(Cirbp) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cirbp.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cold-inducible RNA-binding protein(Cirbp) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cirbp.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

CIRP / CIRBP Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

CIRP / CIRBP Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cold-inducible RNA-binding protein(Cirbp) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cirbp.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cold-inducible RNA-binding protein(Cirbp) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cirbp.

Mass Cytometry

CIRP / CIRBP Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cold-inducible RNA-binding protein(Cirbp) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cirbp.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cold-inducible RNA-binding protein(Cirbp) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cirbp.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

CIRP / CIRBP Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

CIRP / CIRBP Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cold-inducible RNA-binding protein(Cirbp) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cirbp.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cold-inducible RNA-binding protein(Cirbp) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cirbp.

Mass Cytometry

CIRP / CIRBP Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cold-inducible RNA-binding protein(Cirbp) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cirbp.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cold-inducible RNA-binding protein(Cirbp) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cirbp.

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 1/28/2025