Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Forgot password?
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Quick Order
Products
Antibodies
ELISA and Assay Kits
Research Areas
Infectious Disease
Resources
Purchasing
Reference Material
Contact Us
Location
Corporate Headquarters
Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States
Telephone Numbers
Customer Service: (800) 227-6666 / (650) 697-3600
Contact Us
Additional Contact Details
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Forgot password?
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Quick Order
| Catalog Number | Size | Price |
|---|---|---|
| LS-G136982-20 | 20 µg | $405 |
| LS-G136982-100 | 100 µg | $598 |
| LS-G136982-1 | 1 mg | $1,679 |
1 of 3
2 of 3
3 of 3
Mouse CIRP / CIRBP Protein (Recombinant 6His, N-terminus) (Full Length) - LS-G136982
Mouse CIRP / CIRBP Protein (Recombinant 6His, N-terminus) (Full Length) - LS-G136982
Description:
CIRP / CIRBP Protein LS-G136982 is a Recombinant Mouse CIRP / CIRBP produced in E. coli 1-172aa with 6His, N-terminus tag(s). For Research Use Only
Toll Free North America
(800) 227-6666
(800) 227-6666For Research Use Only
Overview
Description:
CIRP / CIRBP Protein LS-G136982 is a Recombinant Mouse CIRP / CIRBP produced in E. coli 1-172aa with 6His, N-terminus tag(s). For Research Use Only
Specifications
Type
Recombinant Protein
Target
CIRP / CIRBP
Synonyms
CIRBP | A18 hnRNP | A18HNRNP | CIRP
Species
Mouse
Modifications
Unmodified
Conjugations
Unconjugated
Tag
6His, N-terminus
Region
1-172aa
Predicted Molecular Weight
22.6 kDa
AA Sequence
MASDEGKLFVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRSRGRGFSRGGGDRGYGGGRFESRSGGYGGSRDYYASRSQGGSYGYRSSGGSYRDSYDSYATHNE
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 90% by SDS-PAGE
Usage Summary
Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Promotes assembly of stress granules (SGs), when overexpressed. Seems to play an essential role in cold-induced suppression of cell proliferation. Acts as a translational repressor. Acts as a translational activator. Binds specifically to the 3'-untranslated regions (3'-UTRs) of stress-responsive transcripts RPA2 and TXN.
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
10 mM Tris-HCL, 1mM EDTA, 6% Trehalose, pH 8.0
Reconstitution
Briefly centrifuge vial prior to opening. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% of glycerol (final concentration).
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
About CIRP / CIRBP
Publications (0)
Customer Reviews (0)
Images
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cold-inducible RNA-binding protein(Cirbp) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cirbp.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cold-inducible RNA-binding protein(Cirbp) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cirbp.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cold-inducible RNA-binding protein(Cirbp) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cirbp.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cold-inducible RNA-binding protein(Cirbp) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cirbp.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cold-inducible RNA-binding protein(Cirbp) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cirbp.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cold-inducible RNA-binding protein(Cirbp) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cirbp.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cold-inducible RNA-binding protein(Cirbp) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cirbp.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cold-inducible RNA-binding protein(Cirbp) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cirbp.
Popular CIRP / CIRBP Proteins
Request SDS/MSDS
To request an SDS/MSDS form for this product, please contact our Technical Support department at:
Technical.Support@LSBio.com
Requested From: United States
Date Requested: 11/25/2024
Date Requested: 11/25/2024
