Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Forgot password?
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Quick Order
Products
Antibodies
ELISA and Assay Kits
Research Areas
Infectious Disease
Resources
Purchasing
Reference Material
Contact Us
Location
Corporate Headquarters
Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States
Telephone Numbers
Customer Service: (800) 227-6666 / (650) 697-3600
Contact Us
Additional Contact Details
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Forgot password?
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Quick Order
| Catalog Number | Size | Price |
|---|---|---|
| LS-G136531-20 | 20 µg | $405 |
| LS-G136531-100 | 100 µg | $598 |
| LS-G136531-1 | 1 mg | $1,679 |
1 of 3
2 of 3
3 of 3
Mouse C1QTNF3 / CTRP3 Protein (Recombinant 10His, N-terminus + Myc, C-terminus) (Full Length) - LS-G136531
Mouse C1QTNF3 / CTRP3 Protein (Recombinant 10His, N-terminus + Myc, C-terminus) (Full Length) - LS-G136531
Description:
C1QTNF3 / CTRP3 Protein LS-G136531 is a Recombinant Mouse C1QTNF3 / CTRP3 produced in E. coli 23-246aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only
Toll Free North America
(800) 227-6666
(800) 227-6666For Research Use Only
Overview
Description:
C1QTNF3 / CTRP3 Protein LS-G136531 is a Recombinant Mouse C1QTNF3 / CTRP3 produced in E. coli 23-246aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only
Specifications
Type
Recombinant Protein
Target
C1QTNF3 / CTRP3
Synonyms
C1QTNF3 | C1ATNF3 | Cartonectin | CORS | CORCS | CORS-26 | CTRP3 | CORS26 | Secretory protein CORS26
Species
Mouse
Modifications
Unmodified
Conjugations
Unconjugated
Tag
10His, N-terminus + Myc, C-terminus
Region
23-246aa
Predicted Molecular Weight
31.1 kDa
AA Sequence
QDEYMESPQAGGLPPDCSKCCHGDYGFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGVPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 90% by SDS-PAGE
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
About C1QTNF3 / CTRP3
Publications (0)
Customer Reviews (0)
Images
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3(C1qtnf3) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) C1qtnf3.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3(C1qtnf3) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) C1qtnf3.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3(C1qtnf3) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) C1qtnf3.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3(C1qtnf3) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) C1qtnf3.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3(C1qtnf3) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) C1qtnf3.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3(C1qtnf3) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) C1qtnf3.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3(C1qtnf3) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) C1qtnf3.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3(C1qtnf3) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) C1qtnf3.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Request SDS/MSDS
To request an SDS/MSDS form for this product, please contact our Technical Support department at:
Technical.Support@LSBio.com
Requested From: United States
Date Requested: 2/8/2025
Date Requested: 2/8/2025
