Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Forgot password?
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Quick Order
Products
Antibodies
ELISA and Assay Kits
Research Areas
Infectious Disease
Resources
Purchasing
Reference Material
Contact Us
Location
Corporate Headquarters
Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States
Telephone Numbers
Customer Service: (800) 227-6666 / (650) 697-3600
Contact Us
Additional Contact Details
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Forgot password?
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Quick Order
| Catalog Number | Size | Price |
|---|---|---|
| LS-G136405-20 | 20 µg | $364 |
| LS-G136405-100 | 100 µg | $500 |
| LS-G136405-1 | 1 mg | $1,679 |
1 of 2
2 of 2
Human NRL Protein (Recombinant 10His, N-terminus + Myc, C-terminus) (Full Length) - LS-G136405
Human NRL Protein (Recombinant 10His, N-terminus + Myc, C-terminus) (Full Length) - LS-G136405
Description:
NRL Protein LS-G136405 is a Recombinant Human NRL produced in E. coli 1-237aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only
Toll Free North America
(800) 227-6666
(800) 227-6666For Research Use Only
Overview
Description:
NRL Protein LS-G136405 is a Recombinant Human NRL produced in E. coli 1-237aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only
Specifications
Type
Recombinant Protein
Target
NRL
Synonyms
NRL | D14S46E | Neural retina leucine zipper | NRL-MAF | RP27
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
10His, N-terminus + Myc, C-terminus
Region
1-237aa
Predicted Molecular Weight
33.4 kDa
AA Sequence
MALPPSPLAMEYVNDFDLMKFEVKREPSEGRPGPPTASLGSTPYSSVPPSPTFSEPGMVGATEGTRPGLEELYWLATLQQQLGAGEALGLSPEEAMELLQGQGPVPVDGPHGYYPGSPEETGAQHVQLAERFSDAALVSMSVRELNRQLRGCGRDEALRLKQRRRTLKNRGYAQACRSKRLQQRRGLEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSSGPGSGDPSHLFL
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 85% by SDS-PAGE
Usage Summary
Acts as a transcriptional activator which regulates the expression of several rod-specific genes, including RHO and PDE6B
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
About NRL
Publications (0)
Customer Reviews (0)
Images
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Neural retina-specific leucine zipper protein(NRL) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NRL.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Neural retina-specific leucine zipper protein(NRL) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NRL.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Neural retina-specific leucine zipper protein(NRL) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NRL.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Neural retina-specific leucine zipper protein(NRL) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NRL.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Neural retina-specific leucine zipper protein(NRL) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NRL.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Neural retina-specific leucine zipper protein(NRL) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NRL.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Neural retina-specific leucine zipper protein(NRL) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NRL.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Neural retina-specific leucine zipper protein(NRL) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NRL.
Request SDS/MSDS
To request an SDS/MSDS form for this product, please contact our Technical Support department at:
Technical.Support@LSBio.com
Requested From: United States
Date Requested: 2/1/2025
Date Requested: 2/1/2025
