Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Location


Corporate Headquarters

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Telephone Numbers



Customer Service: (800) 227-6666 / (650) 697-3600


Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G136405-20 20 µg $364 
LS-G136405-100 100 µg $500 
LS-G136405-1 1 mg $1,679 
NRL Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Neural retina-specific leucine zipper protein(NRL) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NRL.
NRL Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Neural retina-specific leucine zipper protein(NRL) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NRL.
NRL Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Neural retina-specific leucine zipper protein(NRL) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NRL.
NRL Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Neural retina-specific leucine zipper protein(NRL) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NRL.
1 of 2
2 of 2

Human NRL Protein (Recombinant 10His, N-terminus + Myc, C-terminus) (Full Length) - LS-G136405

Human NRL Protein (Recombinant 10His, N-terminus + Myc, C-terminus) (Full Length) - LS-G136405

Description:
NRL Protein LS-G136405 is a Recombinant Human NRL produced in E. coli 1-237aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only
Price
Catalog Number
$364
LS-G136405-20
Toll Free North America
(800) 227-6666
For Research Use Only

Overview

Description:
NRL Protein LS-G136405 is a Recombinant Human NRL produced in E. coli 1-237aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
NRL
Synonyms
NRL | D14S46E | Neural retina leucine zipper | NRL-MAF | RP27
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
10His, N-terminus + Myc, C-terminus
Region
1-237aa
Predicted Molecular Weight
33.4 kDa
AA Sequence
MALPPSPLAMEYVNDFDLMKFEVKREPSEGRPGPPTASLGSTPYSSVPPSPTFSEPGMVGATEGTRPGLEELYWLATLQQQLGAGEALGLSPEEAMELLQGQGPVPVDGPHGYYPGSPEETGAQHVQLAERFSDAALVSMSVRELNRQLRGCGRDEALRLKQRRRTLKNRGYAQACRSKRLQQRRGLEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSSGPGSGDPSHLFL
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 85% by SDS-PAGE
Usage Summary
Acts as a transcriptional activator which regulates the expression of several rod-specific genes, including RHO and PDE6B
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About NRL
P54845 NM_006177 NP_006168.1

Publications (0)

Customer Reviews (0)

Images

Mass Cytometry

NRL Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Neural retina-specific leucine zipper protein(NRL) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NRL.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Neural retina-specific leucine zipper protein(NRL) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NRL.

Mass Cytometry

NRL Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Neural retina-specific leucine zipper protein(NRL) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NRL.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Neural retina-specific leucine zipper protein(NRL) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NRL.

Mass Cytometry

NRL Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Neural retina-specific leucine zipper protein(NRL) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NRL.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Neural retina-specific leucine zipper protein(NRL) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NRL.

Mass Cytometry

NRL Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Neural retina-specific leucine zipper protein(NRL) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NRL.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Neural retina-specific leucine zipper protein(NRL) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NRL.

Mass Cytometry

NRL Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Neural retina-specific leucine zipper protein(NRL) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NRL.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Neural retina-specific leucine zipper protein(NRL) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NRL.

Mass Cytometry

NRL Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Neural retina-specific leucine zipper protein(NRL) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NRL.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Neural retina-specific leucine zipper protein(NRL) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NRL.

Mass Cytometry

NRL Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Neural retina-specific leucine zipper protein(NRL) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NRL.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Neural retina-specific leucine zipper protein(NRL) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NRL.

Mass Cytometry

NRL Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Neural retina-specific leucine zipper protein(NRL) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NRL.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Neural retina-specific leucine zipper protein(NRL) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NRL.

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 2/1/2025