Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Forgot password?
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Quick Order
Products
Antibodies
ELISA and Assay Kits
Research Areas
Infectious Disease
Resources
Purchasing
Reference Material
Contact Us
Location
Corporate Headquarters
Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States
Telephone Numbers
Customer Service: (800) 227-6666 / (650) 697-3600
Contact Us
Additional Contact Details
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Forgot password?
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Quick Order
| Catalog Number | Size | Price |
|---|---|---|
| LS-G136404-20 | 20 µg | $364 |
| LS-G136404-100 | 100 µg | $500 |
| LS-G136404-1 | 1 mg | $1,679 |
1 of 2
2 of 2
Human MMP20 Protein (Recombinant 10His, N-terminus + Myc, C-terminus) (Full Length) - LS-G136404
Human MMP20 Protein (Recombinant 10His, N-terminus + Myc, C-terminus) (Full Length) - LS-G136404
Description:
MMP20 Protein LS-G136404 is a Recombinant Human MMP20 produced in E. coli 108-483aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only
Toll Free North America
(800) 227-6666
(800) 227-6666For Research Use Only
Overview
Description:
MMP20 Protein LS-G136404 is a Recombinant Human MMP20 produced in E. coli 108-483aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only
Specifications
Type
Recombinant Protein
Target
MMP20
Synonyms
MMP20 | AI2A2 | Enamel metalloproteinase | Enamelysin | Matrix metallopeptidase 20 | MMP-20 | Matrix metalloproteinase-20
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
10His, N-terminus + Myc, C-terminus
Region
108-483aa
Predicted Molecular Weight
47.6 kDa
AA Sequence
YRLFPGEPKWKKNTLTYRISKYTPSMSSVEVDKAVEMALQAWSSAVPLSFVRINSGEADIMISFENGDHGDSYPFDGPRGTLAHAFAPGEGLGGDTHFDNAEKWTMGTNGFNLFTVAAHEFGHALGLAHSTDPSALMYPTYKYKNPYGFHLPKDDVKGIQALYGPRKVFLGKPTLPHAPHHKPSIPDLCDSSSSFDAVTMLGKELLLFKDRIFWRRQVHLRTGIRPSTITSSFPQLMSNVDAAYEVAERGTAYFFKGPHYWITRGFQMQGPPRTIYDFGFPRHVQQIDAAVYLREPQKTLFFVGDEYYSYDERKRKMEKDYPKNTEEEFSGVNGQIDAAVELNGYIYFFSGPKTYKYDTEKEDVVSVVKSSSWIGC
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 85% by SDS-PAGE
Usage Summary
Degrades amelogenin, the major protein component of the enamel matrix and two of the macromolecules characterizing the cartilage extracellular matrix
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
About MMP20
Publications (0)
Customer Reviews (0)
Images
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Matrix metalloproteinase-20(MMP20) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) MMP20.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Matrix metalloproteinase-20(MMP20) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) MMP20.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Matrix metalloproteinase-20(MMP20) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) MMP20.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Matrix metalloproteinase-20(MMP20) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) MMP20.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Matrix metalloproteinase-20(MMP20) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) MMP20.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Matrix metalloproteinase-20(MMP20) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) MMP20.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Matrix metalloproteinase-20(MMP20) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) MMP20.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Matrix metalloproteinase-20(MMP20) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) MMP20.
Popular MMP20 Proteins
Request SDS/MSDS
To request an SDS/MSDS form for this product, please contact our Technical Support department at:
Technical.Support@LSBio.com
Requested From: United States
Date Requested: 12/27/2024
Date Requested: 12/27/2024
