Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Location


Corporate Headquarters

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Telephone Numbers



Customer Service: (800) 227-6666 / (650) 697-3600


Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G137016-20 20 µg $405 
LS-G137016-100 100 µg $598 
LS-G137016-1 1 mg $1,679 
FPR1 / FPR Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
FPR1 / FPR Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human fMet-Leu-Phe receptor(FPR1),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FPR1.
FPR1 / FPR Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human fMet-Leu-Phe receptor(FPR1),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FPR1.
FPR1 / FPR Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
FPR1 / FPR Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human fMet-Leu-Phe receptor(FPR1),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FPR1.
FPR1 / FPR Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human fMet-Leu-Phe receptor(FPR1),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FPR1.
1 of 3
2 of 3
3 of 3

Human FPR1 / FPR Protein (Recombinant 10His-GST, N-terminus + Myc, C-terminus) - LS-G137016

Human FPR1 / FPR Protein (Recombinant 10His-GST, N-terminus + Myc, C-terminus) - LS-G137016

Description:
FPR1 / FPR Protein LS-G137016 is a Recombinant Human FPR1 / FPR produced in E. coli 306-350aa with 10His-GST, N-terminus + Myc, C-terminus tag(s). For Research Use Only
Price
Catalog Number
$405
LS-G137016-20
Toll Free North America
(800) 227-6666
For Research Use Only

Overview

Description:
FPR1 / FPR Protein LS-G137016 is a Recombinant Human FPR1 / FPR produced in E. coli 306-350aa with 10His-GST, N-terminus + Myc, C-terminus tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
FPR1 / FPR
Synonyms
FPR1 | FPR-1 | FMet-Leu-Phe receptor | FMLP | Formyl peptide receptor 1 | FPR | N-formyl peptide receptor | FMLP receptor | Fpr receptor | N-formyl peptide receptor 1
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
10His-GST, N-terminus + Myc, C-terminus
Region
306-350aa
Predicted Molecular Weight
34.9 kDa
AA Sequence
QDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 85% by SDS-PAGE
Usage Summary
High affinity receptor for N-formyl-methionyl peptides (fMLP), which are powerful neutrophil chemotactic factors
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About FPR1 / FPR
P21462 NM_002029 NP_002020.1

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

FPR1 / FPR Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

FPR1 / FPR Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human fMet-Leu-Phe receptor(FPR1),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FPR1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human fMet-Leu-Phe receptor(FPR1),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FPR1.

Mass Cytometry

FPR1 / FPR Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human fMet-Leu-Phe receptor(FPR1),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FPR1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human fMet-Leu-Phe receptor(FPR1),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FPR1.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

FPR1 / FPR Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

FPR1 / FPR Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human fMet-Leu-Phe receptor(FPR1),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FPR1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human fMet-Leu-Phe receptor(FPR1),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FPR1.

Mass Cytometry

FPR1 / FPR Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human fMet-Leu-Phe receptor(FPR1),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FPR1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human fMet-Leu-Phe receptor(FPR1),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FPR1.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

FPR1 / FPR Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

FPR1 / FPR Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human fMet-Leu-Phe receptor(FPR1),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FPR1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human fMet-Leu-Phe receptor(FPR1),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FPR1.

Mass Cytometry

FPR1 / FPR Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human fMet-Leu-Phe receptor(FPR1),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FPR1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human fMet-Leu-Phe receptor(FPR1),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FPR1.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

FPR1 / FPR Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

FPR1 / FPR Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human fMet-Leu-Phe receptor(FPR1),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FPR1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human fMet-Leu-Phe receptor(FPR1),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FPR1.

Mass Cytometry

FPR1 / FPR Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human fMet-Leu-Phe receptor(FPR1),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FPR1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human fMet-Leu-Phe receptor(FPR1),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FPR1.

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 1/2/2025