LSBio logo with text
Products
Research Areas
COVID-19
Resources
Contact Us
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Cart
How To Buy
Contact Us

Location

Corporate Headquarters

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Telephone Numbers


Customer Service: (800) 227-6666 / (650) 697-3600


Contact Us


Additional Contact Details

Distributors
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Proteins > ARID1A / BAF250 > LS-G136957
 
Print Page  
Catalog Number Size Price
LS-G136957-20 20 µg $405 
LS-G136957-100 100 µg $598 
LS-G136957-1 1 mg $1,679 
ARID1A / BAF250 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
ARID1A / BAF250 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.
ARID1A / BAF250 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.
ARID1A / BAF250 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
ARID1A / BAF250 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.
ARID1A / BAF250 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.
1 of 3
2 of 3
3 of 3

Human ARID1A / BAF250 Protein (Recombinant 10His, N-terminus + Myc, C-terminus) - LS-G136957

Human ARID1A / BAF250 Protein (Recombinant 10His, N-terminus + Myc, C-terminus) - LS-G136957

Submit Review LSBio Guarantee
Description:
ARID1A / BAF250 Protein LS-G136957 is a Recombinant Human ARID1A / BAF250 produced in E. coli 1976-2231aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only
Price
Catalog Number
$405
LS-G136957-20
Toll Free North America
(800) 227-6666
For Research Use Only
Specifications Publications Reviews Images Popular ARID1A / BAF250 Proteins Request SDS/MSDS

Overview

Description:
ARID1A / BAF250 Protein LS-G136957 is a Recombinant Human ARID1A / BAF250 produced in E. coli 1976-2231aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
ARID1A / BAF250
Synonyms
ARID1A | BAF250 | BAF250a | BRG1-associated factor 250a | C1orf4 | BRG1-associated factor 250 | ELD | HOSA1 | Osa homolog 1 | OSA1 | OSA1 nuclear protein | SMARCF1 | MRD14 | p270 | B120 | BM029 | Brain protein 120 | C10rf4 | HELD | SWI-like protein | SWI/SNF complex protein p270
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
10His, N-terminus + Myc, C-terminus
Region
1976-2231aa
Predicted Molecular Weight
33.4 kDa
AA Sequence
SLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMM
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 85% by SDS-PAGE
Usage Summary
Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome in an ATP-dependent manner. Binds DNA non-specifically. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a postmitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to postmitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth (By similarity).
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About ARID1A / BAF250
O14497 NM_006015 NP_006006.3

Publications (0)

Submit a Publication for LS-G136957

Customer Reviews (0)

Submit a review for LS-G136957

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

ARID1A / BAF250 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

ARID1A / BAF250 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.

Mass Cytometry

ARID1A / BAF250 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

ARID1A / BAF250 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

ARID1A / BAF250 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.

Mass Cytometry

ARID1A / BAF250 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

ARID1A / BAF250 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

ARID1A / BAF250 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.

Mass Cytometry

ARID1A / BAF250 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

ARID1A / BAF250 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

ARID1A / BAF250 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.

Mass Cytometry

ARID1A / BAF250 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.

Popular ARID1A / BAF250 Proteins

Product
Human ARID1A / BAF250 Protein (Recombinant His) (aa1201-1430) - LS-G141047
Source: E. coli
Tag: His
ARID1A / BAF250 Protein - Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Human ARID1A / BAF250 Protein (Over-Expression Lysate Myc-DDK (Flag)) (Full Length) - LS-G88844
Source: Human
Tag: Myc-DDK (Flag)

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com
Requested From: United States
Date Requested: 11/21/2024
Family of Companies
Site Links Home All Antibodies How To Buy All Proteins Distributors All ELISA & Assay Kits Reviews PathPlus™ Antibodies
Follow LSBio View Cart Register or Login
Copyright © 2024 LifeSpan BioSciences, Inc - Privacy Policy
Contact Us

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Tel: (800) 227-6666 / (650) 697-3600

To place an order:
customerservice@vectorlabs.com

For questions about orders:
Customer.Support@LSBio.com

For technical assistance:
Technical.Support@LSBio.com