Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Forgot password?
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Quick Order
Products
Antibodies
ELISA and Assay Kits
Research Areas
Infectious Disease
Resources
Purchasing
Reference Material
Contact Us
Location
Corporate Headquarters
Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States
Telephone Numbers
Customer Service: (800) 227-6666 / (650) 697-3600
Contact Us
Additional Contact Details
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Forgot password?
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Quick Order
| Catalog Number | Size | Price |
|---|---|---|
| LS-G136538-20 | 20 µg | $364 |
| LS-G136538-100 | 100 µg | $500 |
| LS-G136538-1 | 1 mg | $1,679 |
1 of 3
2 of 3
3 of 3
Human AK3 / Adenylate Kinase 3 Protein (Recombinant 10His, N-terminus + Myc, C-terminus) (Full Length) - LS-G136538
Human AK3 / Adenylate Kinase 3 Protein (Recombinant 10His, N-terminus + Myc, C-terminus) (Full Length) - LS-G136538
Description:
AK3 / Adenylate Kinase 3 Protein LS-G136538 is a Recombinant Human AK3 / Adenylate Kinase 3 produced in E. coli 1-227aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only
Toll Free North America
(800) 227-6666
(800) 227-6666For Research Use Only
Overview
Description:
AK3 / Adenylate Kinase 3 Protein LS-G136538 is a Recombinant Human AK3 / Adenylate Kinase 3 produced in E. coli 1-227aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only
Specifications
Type
Recombinant Protein
Target
AK3 / Adenylate Kinase 3
Synonyms
AK3 | AK 3 | AKL3L1 | Adenylate kinase 3 alpha like | Adenylate kinase 3 like 1 | Adenylate kinase 3 | Adenylate kinase 6 | AK3L1 | AK6 | AKL3L | FIX
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
10His, N-terminus + Myc, C-terminus
Region
1-227aa
Predicted Molecular Weight
32.6 kDa
AA Sequence
MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 90% by SDS-PAGE
Usage Summary
Involved in maintaining the homeostasis of cellular nucleotides by catalyzing the interconversion of nucleoside phosphates. Has GTP
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
About AK3 / Adenylate Kinase 3
Publications (0)
Customer Reviews (0)
Images
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human GTP:AMP phosphotransferase, mitochondrial(AK3) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AK3.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human GTP:AMP phosphotransferase, mitochondrial(AK3) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AK3.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human GTP:AMP phosphotransferase, mitochondrial(AK3) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AK3.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human GTP:AMP phosphotransferase, mitochondrial(AK3) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AK3.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human GTP:AMP phosphotransferase, mitochondrial(AK3) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AK3.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human GTP:AMP phosphotransferase, mitochondrial(AK3) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AK3.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human GTP:AMP phosphotransferase, mitochondrial(AK3) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AK3.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human GTP:AMP phosphotransferase, mitochondrial(AK3) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AK3.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Request SDS/MSDS
To request an SDS/MSDS form for this product, please contact our Technical Support department at:
Technical.Support@LSBio.com
Requested From: United States
Date Requested: 12/22/2024
Date Requested: 12/22/2024
