LSBio logo with text
Products
Research Areas
COVID-19
Resources
Contact Us
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Cart
How To Buy
Contact Us

Location

Corporate Headquarters

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Telephone Numbers


Customer Service: (800) 227-6666 / (650) 697-3600


Contact Us


Additional Contact Details

Distributors
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Proteins > ADAMTS18 > LS-G136512
 
Print Page  
Catalog Number Size Price
LS-G136512-20 20 µg $364 
LS-G136512-100 100 µg $500 
LS-G136512-1 1 mg $1,679 
ADAMTS18 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18(ADAMTS18),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ADAMTS18.
ADAMTS18 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18(ADAMTS18),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ADAMTS18.
ADAMTS18 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
ADAMTS18 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18(ADAMTS18),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ADAMTS18.
ADAMTS18 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18(ADAMTS18),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ADAMTS18.
ADAMTS18 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
1 of 3
2 of 3
3 of 3

Human ADAMTS18 Protein (Recombinant 6His, N-terminus) - LS-G136512

Human ADAMTS18 Protein (Recombinant 6His, N-terminus) - LS-G136512

Submit Review LSBio Guarantee
Description:
ADAMTS18 Protein LS-G136512 is a Recombinant Human ADAMTS18 produced in E. coli 842-1047aa with 6His, N-terminus tag(s). For Research Use Only
Price
Catalog Number
$364
LS-G136512-20
Toll Free North America
(800) 227-6666
For Research Use Only
Specifications Publications Reviews Images Request SDS/MSDS

Overview

Description:
ADAMTS18 Protein LS-G136512 is a Recombinant Human ADAMTS18 produced in E. coli 842-1047aa with 6His, N-terminus tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
ADAMTS18
Synonyms
ADAMTS18 | ADAMTS-18 | ADAM-TS 18 | ADAM-TS18 | ADAMTS21 | KNO2
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
6His, N-terminus
Region
842-1047aa
Predicted Molecular Weight
15.5 kDa
AA Sequence
TCSKACAGGQQSRKIQCVQKKPFQKEEAVLHSLCPVSTPTQVQACNSHACPPQWSLGPWSQCSKTCGRGVRKRELLCKGSAAETLPESQCTSLPRPELQEGCVLGR
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 85% by SDS-PAGE
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About ADAMTS18
Q8TE60 NM_199355 NP_955387.1

Publications (0)

Submit a Publication for LS-G136512

Customer Reviews (0)

Submit a review for LS-G136512

Images

Mass Cytometry

ADAMTS18 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18(ADAMTS18),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ADAMTS18.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18(ADAMTS18),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ADAMTS18.

Mass Cytometry

ADAMTS18 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18(ADAMTS18),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ADAMTS18.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18(ADAMTS18),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ADAMTS18.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

ADAMTS18 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

ADAMTS18 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18(ADAMTS18),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ADAMTS18.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18(ADAMTS18),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ADAMTS18.

Mass Cytometry

ADAMTS18 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18(ADAMTS18),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ADAMTS18.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18(ADAMTS18),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ADAMTS18.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

ADAMTS18 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

ADAMTS18 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18(ADAMTS18),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ADAMTS18.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18(ADAMTS18),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ADAMTS18.

Mass Cytometry

ADAMTS18 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18(ADAMTS18),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ADAMTS18.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18(ADAMTS18),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ADAMTS18.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

ADAMTS18 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

ADAMTS18 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18(ADAMTS18),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ADAMTS18.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18(ADAMTS18),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ADAMTS18.

Mass Cytometry

ADAMTS18 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18(ADAMTS18),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ADAMTS18.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18(ADAMTS18),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ADAMTS18.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

ADAMTS18 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com
Requested From: United States
Date Requested: 11/21/2024
Family of Companies
Site Links Home All Antibodies How To Buy All Proteins Distributors All ELISA & Assay Kits Reviews PathPlus™ Antibodies
Follow LSBio View Cart Register or Login
Copyright © 2024 LifeSpan BioSciences, Inc - Privacy Policy
Contact Us

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Tel: (800) 227-6666 / (650) 697-3600

To place an order:
customerservice@vectorlabs.com

For questions about orders:
Customer.Support@LSBio.com

For technical assistance:
Technical.Support@LSBio.com