Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G136541-20 20 µg $364 
LS-G136541-100 100 µg $500 
LS-G136541-1 1 mg $1,679 
ACTL8 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Actin-like protein 8(ACTL8) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACTL8.
ACTL8 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Actin-like protein 8(ACTL8) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACTL8.
ACTL8 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
ACTL8 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Actin-like protein 8(ACTL8) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACTL8.
ACTL8 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Actin-like protein 8(ACTL8) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACTL8.
ACTL8 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
1 of 3
2 of 3
3 of 3

Human ACTL8 Protein (Recombinant 6His, N-terminus + Myc, C-terminus) (Full Length) - LS-G136541

Human ACTL8 Protein (Recombinant 6His, N-terminus + Myc, C-terminus) (Full Length) - LS-G136541

Description:
ACTL8 Protein LS-G136541 is a Recombinant Human ACTL8 produced in E. coli 1-366aa with 6His, N-terminus + Myc, C-terminus tag(s). For Research Use Only
Price
Catalog Number
$364
LS-G136541-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
ACTL8 Protein LS-G136541 is a Recombinant Human ACTL8 produced in E. coli 1-366aa with 6His, N-terminus + Myc, C-terminus tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
ACTL8
Synonyms
ACTL8 | Actin like protein | Actin-like 8 | CT57 | Actin-like protein 8 | Cancer/testis antigen 57
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
6His, N-terminus + Myc, C-terminus
Region
1-366aa
Predicted Molecular Weight
46.9 kDa
AA Sequence
MAARTVIIDHGSGFLKAGTAGWNEPQMVFPNIVNYLPCKENPGPSYARRRVSLGIDICHPDTFSYPIERGRILNWEGVQYLWSFVLENHRREQEVPPVIITETPLREPADRKKMLEILFELLHVPSVLLADQLQMSLYASGLLTGVVVDSGYGLTRVQPFHQGRPLPASGKTLEFAGQDLSAYLLKSLFKEDCDRRCLFQLETVAVTQMNKCYVPQNLGEALDFRERQQSALDESNTYQLPDGSRVELTPMQRVAPEMFFSPQVFEQPGPSIPRAIVESVESCEISLRPLLVSHVMACGGNTLYPGFTKRLFRELMGDHVSSTKATVWEGSNRNFSVWLGASVVAHLSTYQSEWMSREEYGEHMRM
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 85% by SDS-PAGE
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About ACTL8
Q9H568 Q9H568

Publications (0)

Customer Reviews (0)

Images

Mass Cytometry

ACTL8 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Actin-like protein 8(ACTL8) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACTL8.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Actin-like protein 8(ACTL8) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACTL8.

Mass Cytometry

ACTL8 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Actin-like protein 8(ACTL8) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACTL8.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Actin-like protein 8(ACTL8) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACTL8.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

ACTL8 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

ACTL8 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Actin-like protein 8(ACTL8) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACTL8.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Actin-like protein 8(ACTL8) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACTL8.

Mass Cytometry

ACTL8 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Actin-like protein 8(ACTL8) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACTL8.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Actin-like protein 8(ACTL8) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACTL8.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

ACTL8 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

ACTL8 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Actin-like protein 8(ACTL8) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACTL8.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Actin-like protein 8(ACTL8) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACTL8.

Mass Cytometry

ACTL8 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Actin-like protein 8(ACTL8) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACTL8.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Actin-like protein 8(ACTL8) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACTL8.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

ACTL8 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

ACTL8 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Actin-like protein 8(ACTL8) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACTL8.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Actin-like protein 8(ACTL8) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACTL8.

Mass Cytometry

ACTL8 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Actin-like protein 8(ACTL8) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACTL8.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Actin-like protein 8(ACTL8) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACTL8.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

ACTL8 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 7/22/2024