Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G136949-20 20 µg $406 
LS-G136949-100 100 µg $503 
LS-G136949-1 1 mg $1,443 
ACP1 / Acid Phosphatase Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
ACP1 / Acid Phosphatase Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Low molecular weight phosphotyrosine protein phosphatase(ACP1) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACP1.
ACP1 / Acid Phosphatase Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Low molecular weight phosphotyrosine protein phosphatase(ACP1) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACP1.
ACP1 / Acid Phosphatase Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
ACP1 / Acid Phosphatase Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Low molecular weight phosphotyrosine protein phosphatase(ACP1) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACP1.
ACP1 / Acid Phosphatase Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Low molecular weight phosphotyrosine protein phosphatase(ACP1) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACP1.
1 of 3
2 of 3
3 of 3

Human ACP1 / Acid Phosphatase Protein (Recombinant) (Full Length) - LS-G136949

Human ACP1 / Acid Phosphatase Protein (Recombinant) (Full Length) - LS-G136949

Description:
ACP1 / Acid Phosphatase Protein LS-G136949 is a Recombinant Human ACP1 / Acid Phosphatase produced in E. coli 1-158aa. For Research Use Only
Price
Catalog Number
$406
LS-G136949-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
ACP1 / Acid Phosphatase Protein LS-G136949 is a Recombinant Human ACP1 / Acid Phosphatase produced in E. coli 1-158aa. For Research Use Only

Specifications

Type
Recombinant Protein
Target
ACP1 / Acid Phosphatase
Synonyms
ACP1 | Acid Phosphatase | Acid phosphatase 1, soluble | Acid phosphatase 1 soluble | Adipocyte acid phosphatase | LMW-PTP | HAAP | Red cell acid phosphatase 1 | LMW-PTPase | Protein tyrosine phosphatase
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Region
1-158aa
Predicted Molecular Weight
18.0 kDa
AA Sequence
MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 90% by SDS-PAGE
Usage Summary
Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates. Isoform 3 does not possess phosphatase activity.
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About ACP1 / Acid Phosphatase
P24666 NM_004300 NP_004291.1

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

ACP1 / Acid Phosphatase Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

ACP1 / Acid Phosphatase Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Low molecular weight phosphotyrosine protein phosphatase(ACP1) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACP1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Low molecular weight phosphotyrosine protein phosphatase(ACP1) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACP1.

Mass Cytometry

ACP1 / Acid Phosphatase Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Low molecular weight phosphotyrosine protein phosphatase(ACP1) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACP1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Low molecular weight phosphotyrosine protein phosphatase(ACP1) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACP1.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

ACP1 / Acid Phosphatase Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

ACP1 / Acid Phosphatase Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Low molecular weight phosphotyrosine protein phosphatase(ACP1) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACP1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Low molecular weight phosphotyrosine protein phosphatase(ACP1) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACP1.

Mass Cytometry

ACP1 / Acid Phosphatase Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Low molecular weight phosphotyrosine protein phosphatase(ACP1) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACP1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Low molecular weight phosphotyrosine protein phosphatase(ACP1) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACP1.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

ACP1 / Acid Phosphatase Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

ACP1 / Acid Phosphatase Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Low molecular weight phosphotyrosine protein phosphatase(ACP1) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACP1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Low molecular weight phosphotyrosine protein phosphatase(ACP1) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACP1.

Mass Cytometry

ACP1 / Acid Phosphatase Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Low molecular weight phosphotyrosine protein phosphatase(ACP1) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACP1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Low molecular weight phosphotyrosine protein phosphatase(ACP1) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACP1.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

ACP1 / Acid Phosphatase Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

ACP1 / Acid Phosphatase Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Low molecular weight phosphotyrosine protein phosphatase(ACP1) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACP1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Low molecular weight phosphotyrosine protein phosphatase(ACP1) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACP1.

Mass Cytometry

ACP1 / Acid Phosphatase Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Low molecular weight phosphotyrosine protein phosphatase(ACP1) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACP1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Low molecular weight phosphotyrosine protein phosphatase(ACP1) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACP1.

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 10/1/2024