Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Forgot password?
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Quick Order
Products
Antibodies
ELISA and Assay Kits
Research Areas
Infectious Disease
Resources
Purchasing
Reference Material
Contact Us
Locations
Orders Processing,
Shipping & Receiving,
Warehouse
2 Shaker Rd Suites
B001/B101
Shirley, MA 01464
Production Lab
Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036
Telephone Numbers
Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565
Contact Us
Additional Contact Details
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Forgot password?
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Quick Order
| Catalog Number | Size | Price |
|---|---|---|
| LS-G137292-20 | 20 µg | $405 |
| LS-G137292-100 | 100 µg | $598 |
| LS-G137292-1 | 1 mg | $1,679 |
1 of 3
2 of 3
3 of 3
E. coli mscL Protein (Recombinant 6His-B2M, N-terminus) (Full Length) - LS-G137292
E. coli mscL Protein (Recombinant 6His-B2M, N-terminus) (Full Length) - LS-G137292
Description:
mscL Protein LS-G137292 is a Recombinant E. coli mscL produced in E. coli 1-136aa with 6His-B2M, N-terminus tag(s). For Research Use Only
Toll Free North America
206-374-1102
206-374-1102For Research Use Only
Overview
Description:
mscL Protein LS-G137292 is a Recombinant E. coli mscL produced in E. coli 1-136aa with 6His-B2M, N-terminus tag(s). For Research Use Only
Specifications
Type
Recombinant Protein
Target
mscL
Synonyms
mscL
Species
E. coli
Modifications
Unmodified
Conjugations
Unconjugated
Tag
6His-B2M, N-terminus
Region
1-136aa
Predicted Molecular Weight
29.0 kDa
AA Sequence
MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVTLRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAIKLINKLNRKKEEPAAAPAPTKEEVLLTEIRDLLKEQNNRS
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 85% by SDS-PAGE
Usage Summary
Channel that opens in response to stretch forces in the membrane lipid bilayer. May participate in the regulation of osmotic pressure changes within the cell.
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
About mscL
Publications (0)
Customer Reviews (0)
Images
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Escherichia coli O157:H7 Large-conductance mechanosensitive channel(mscL) could indicate that this peptide derived from E.coli-expressed Escherichia coli O157:H7 mscL.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Escherichia coli O157:H7 Large-conductance mechanosensitive channel(mscL) could indicate that this peptide derived from E.coli-expressed Escherichia coli O157:H7 mscL.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Escherichia coli O157:H7 Large-conductance mechanosensitive channel(mscL) could indicate that this peptide derived from E.coli-expressed Escherichia coli O157:H7 mscL.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Escherichia coli O157:H7 Large-conductance mechanosensitive channel(mscL) could indicate that this peptide derived from E.coli-expressed Escherichia coli O157:H7 mscL.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Escherichia coli O157:H7 Large-conductance mechanosensitive channel(mscL) could indicate that this peptide derived from E.coli-expressed Escherichia coli O157:H7 mscL.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Escherichia coli O157:H7 Large-conductance mechanosensitive channel(mscL) could indicate that this peptide derived from E.coli-expressed Escherichia coli O157:H7 mscL.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Escherichia coli O157:H7 Large-conductance mechanosensitive channel(mscL) could indicate that this peptide derived from E.coli-expressed Escherichia coli O157:H7 mscL.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Escherichia coli O157:H7 Large-conductance mechanosensitive channel(mscL) could indicate that this peptide derived from E.coli-expressed Escherichia coli O157:H7 mscL.
Request SDS/MSDS
To request an SDS/MSDS form for this product, please contact our Technical Support department at:
Technical.Support@LSBio.com
Requested From: United States
Date Requested: 10/19/2024
Date Requested: 10/19/2024
