Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G136620-20 20 µg $395 
LS-G136620-100 100 µg $570 
LS-G136620-1 1 mg $1,973 
PRA1 Protein - Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Candida albicans pH-regulated antigen PRA1(PRA1) could indicate that this peptide derived from Yeast-expressed Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) PRA1.
PRA1 Protein - Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Candida albicans pH-regulated antigen PRA1(PRA1) could indicate that this peptide derived from Yeast-expressed Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) PRA1.
PRA1 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
PRA1 Protein - Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Candida albicans pH-regulated antigen PRA1(PRA1) could indicate that this peptide derived from Yeast-expressed Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) PRA1.
PRA1 Protein - Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Candida albicans pH-regulated antigen PRA1(PRA1) could indicate that this peptide derived from Yeast-expressed Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) PRA1.
PRA1 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
1 of 3
2 of 3
3 of 3

Candida albicans PRA1 Protein (Recombinant 6His, N-terminus) (Full Length) - LS-G136620

Candida albicans PRA1 Protein (Recombinant 6His, N-terminus) (Full Length) - LS-G136620

Description:
PRA1 Protein LS-G136620 is a Recombinant Candida albicans PRA1 produced in Yeast 16-299aa with 6His, N-terminus tag(s). For Research Use Only
Price
Catalog Number
$395
LS-G136620-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
PRA1 Protein LS-G136620 is a Recombinant Candida albicans PRA1 produced in Yeast 16-299aa with 6His, N-terminus tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
PRA1
Synonyms
PRA1
Species
Candida albicans
Modifications
Unmodified
Conjugations
Unconjugated
Tag
6His, N-terminus
Region
16-299aa
Predicted Molecular Weight
33.4 kDa
AA Sequence
APVTVTRFVDASPTGYDWRADWVKGFPIDSSCNATQYNQLSTGLQEAQLLAEHARDHTLRFGSKSPFFRKYFGNETASAEVVGHFDNVVGADKSSILFLCDDLDDKCKNDGWAGYWRGSNHSDQTIICDLSFVTRRYLTQLCSSGYTVSKSKTNIFWAGDLLHRFWHLKSIGQLVIEHYADTYEEVLELAQENSTYAVRNSNSLIYYALDVYAYDVTIPGEGCNGDGTSYKKSDFSSFEDSDSGSDSGASSTASSSHQHTDSNPSATTDANSHCHTHADGEVHC
Expression System
Yeast
Source Species
Yeast
Purification
Greater than 90% by SDS-PAGE
Usage Summary
Cell surface protein involved in the host-parasite interaction during candidal infection. With MP65, represents a major component of the biofilm matrix. Sequesters zinc from host tissue and mediates leukocyte adhesion and migration. As a surface protein, binds the two human complement regulators CFH and CFHR1, as well as plasminogen PLG, mediates complement evasion and extra-cellular matrix interaction and/or degradation. As a released protein, enhances complement control in direct vicinity of the yeast and thus generates an additional protective layer which controls host complement attack, assisting the fungus in escaping host surveillance. Binds to host fluid-phase C3 and blocks cleavage of C3 to C3a and C3b, leading to inhibition of complement activation. Mediates also human complement control and complement evasion through binding to C4BPA, another human complement inhibitor, as well as through binding to host integrin alpha-M/beta-2. Decreases complement-mediated adhesion, as well as uptake of C.albicans by human macrophages.
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About PRA1
P87020

Publications (0)

Customer Reviews (0)

Images

Mass Cytometry

PRA1 Protein - Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Candida albicans pH-regulated antigen PRA1(PRA1) could indicate that this peptide derived from Yeast-expressed Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) PRA1.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Candida albicans pH-regulated antigen PRA1(PRA1) could indicate that this peptide derived from Yeast-expressed Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) PRA1.

Mass Cytometry

PRA1 Protein - Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Candida albicans pH-regulated antigen PRA1(PRA1) could indicate that this peptide derived from Yeast-expressed Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) PRA1.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Candida albicans pH-regulated antigen PRA1(PRA1) could indicate that this peptide derived from Yeast-expressed Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) PRA1.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

PRA1 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

PRA1 Protein - Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Candida albicans pH-regulated antigen PRA1(PRA1) could indicate that this peptide derived from Yeast-expressed Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) PRA1.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Candida albicans pH-regulated antigen PRA1(PRA1) could indicate that this peptide derived from Yeast-expressed Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) PRA1.

Mass Cytometry

PRA1 Protein - Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Candida albicans pH-regulated antigen PRA1(PRA1) could indicate that this peptide derived from Yeast-expressed Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) PRA1.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Candida albicans pH-regulated antigen PRA1(PRA1) could indicate that this peptide derived from Yeast-expressed Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) PRA1.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

PRA1 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

PRA1 Protein - Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Candida albicans pH-regulated antigen PRA1(PRA1) could indicate that this peptide derived from Yeast-expressed Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) PRA1.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Candida albicans pH-regulated antigen PRA1(PRA1) could indicate that this peptide derived from Yeast-expressed Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) PRA1.

Mass Cytometry

PRA1 Protein - Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Candida albicans pH-regulated antigen PRA1(PRA1) could indicate that this peptide derived from Yeast-expressed Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) PRA1.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Candida albicans pH-regulated antigen PRA1(PRA1) could indicate that this peptide derived from Yeast-expressed Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) PRA1.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

PRA1 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

PRA1 Protein - Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Candida albicans pH-regulated antigen PRA1(PRA1) could indicate that this peptide derived from Yeast-expressed Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) PRA1.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Candida albicans pH-regulated antigen PRA1(PRA1) could indicate that this peptide derived from Yeast-expressed Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) PRA1.

Mass Cytometry

PRA1 Protein - Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Candida albicans pH-regulated antigen PRA1(PRA1) could indicate that this peptide derived from Yeast-expressed Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) PRA1.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Recombinant Candida albicans pH-regulated antigen PRA1(PRA1) could indicate that this peptide derived from Yeast-expressed Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) PRA1.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

PRA1 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/29/2024