Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Location


Corporate Headquarters

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Telephone Numbers



Customer Service: (800) 227-6666 / (650) 697-3600


Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G136398-20 20 µg $405 
LS-G136398-100 100 µg $598 
LS-G136398-1 1 mg $1,679 
FDX1 / ADX Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Bovine Adrenodoxin, mitochondrial(FDX1) could indicate that this peptide derived from E.coli-expressed Bos taurus (Bovine) FDX1.
FDX1 / ADX Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Bovine Adrenodoxin, mitochondrial(FDX1) could indicate that this peptide derived from E.coli-expressed Bos taurus (Bovine) FDX1.
FDX1 / ADX Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
FDX1 / ADX Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Bovine Adrenodoxin, mitochondrial(FDX1) could indicate that this peptide derived from E.coli-expressed Bos taurus (Bovine) FDX1.
FDX1 / ADX Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Bovine Adrenodoxin, mitochondrial(FDX1) could indicate that this peptide derived from E.coli-expressed Bos taurus (Bovine) FDX1.
FDX1 / ADX Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
1 of 3
2 of 3
3 of 3

Bovine FDX1 / ADX Protein (Recombinant 10His, N-terminus) (Full Length) - LS-G136398

Bovine FDX1 / ADX Protein (Recombinant 10His, N-terminus) (Full Length) - LS-G136398

Description:
FDX1 / ADX Protein LS-G136398 is a Recombinant Bovine FDX1 / ADX produced in E. coli 59-186aa with 10His, N-terminus tag(s). For Research Use Only
Price
Catalog Number
$405
LS-G136398-20
Toll Free North America
(800) 227-6666
For Research Use Only

Overview

Description:
FDX1 / ADX Protein LS-G136398 is a Recombinant Bovine FDX1 / ADX produced in E. coli 59-186aa with 10His, N-terminus tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
FDX1 / ADX
Synonyms
FDX1 | Adrenodoxin | ADX | Ferredoxin-1 | Adrenal ferredoxin | Adrenodoxin, mitochondrial | Ferredoxin 1 | LOH11CR1D | FDX | Hepatoredoxin | Mitochondrial adrenodoxin
Species
Bovine
Modifications
Unmodified
Conjugations
Unconjugated
Tag
10His, N-terminus
Region
59-186aa
Predicted Molecular Weight
19.5 kDa
AA Sequence
SSSEDKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVPDAVSDARESIDMGMNSSKIE
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 85% by SDS-PAGE
Usage Summary
Essential for the synthesis of various steroid hormones, participates in the reduction of mitochondrial cytochrome P450 for steroidogenesis. Transfers electrons from adrenodoxin reductase to CYP11A1, a cytochrome P450 that catalyzes cholesterol side-chain cleavage (By similarity).
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About FDX1 / ADX
P10109 NM_004109 NP_004100.1

Publications (0)

Customer Reviews (0)

Images

Mass Cytometry

FDX1 / ADX Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Bovine Adrenodoxin, mitochondrial(FDX1) could indicate that this peptide derived from E.coli-expressed Bos taurus (Bovine) FDX1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Bovine Adrenodoxin, mitochondrial(FDX1) could indicate that this peptide derived from E.coli-expressed Bos taurus (Bovine) FDX1.

Mass Cytometry

FDX1 / ADX Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Bovine Adrenodoxin, mitochondrial(FDX1) could indicate that this peptide derived from E.coli-expressed Bos taurus (Bovine) FDX1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Bovine Adrenodoxin, mitochondrial(FDX1) could indicate that this peptide derived from E.coli-expressed Bos taurus (Bovine) FDX1.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

FDX1 / ADX Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

FDX1 / ADX Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Bovine Adrenodoxin, mitochondrial(FDX1) could indicate that this peptide derived from E.coli-expressed Bos taurus (Bovine) FDX1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Bovine Adrenodoxin, mitochondrial(FDX1) could indicate that this peptide derived from E.coli-expressed Bos taurus (Bovine) FDX1.

Mass Cytometry

FDX1 / ADX Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Bovine Adrenodoxin, mitochondrial(FDX1) could indicate that this peptide derived from E.coli-expressed Bos taurus (Bovine) FDX1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Bovine Adrenodoxin, mitochondrial(FDX1) could indicate that this peptide derived from E.coli-expressed Bos taurus (Bovine) FDX1.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

FDX1 / ADX Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

FDX1 / ADX Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Bovine Adrenodoxin, mitochondrial(FDX1) could indicate that this peptide derived from E.coli-expressed Bos taurus (Bovine) FDX1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Bovine Adrenodoxin, mitochondrial(FDX1) could indicate that this peptide derived from E.coli-expressed Bos taurus (Bovine) FDX1.

Mass Cytometry

FDX1 / ADX Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Bovine Adrenodoxin, mitochondrial(FDX1) could indicate that this peptide derived from E.coli-expressed Bos taurus (Bovine) FDX1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Bovine Adrenodoxin, mitochondrial(FDX1) could indicate that this peptide derived from E.coli-expressed Bos taurus (Bovine) FDX1.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

FDX1 / ADX Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

FDX1 / ADX Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Bovine Adrenodoxin, mitochondrial(FDX1) could indicate that this peptide derived from E.coli-expressed Bos taurus (Bovine) FDX1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Bovine Adrenodoxin, mitochondrial(FDX1) could indicate that this peptide derived from E.coli-expressed Bos taurus (Bovine) FDX1.

Mass Cytometry

FDX1 / ADX Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Bovine Adrenodoxin, mitochondrial(FDX1) could indicate that this peptide derived from E.coli-expressed Bos taurus (Bovine) FDX1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Bovine Adrenodoxin, mitochondrial(FDX1) could indicate that this peptide derived from E.coli-expressed Bos taurus (Bovine) FDX1.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

FDX1 / ADX Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 3/28/2025