Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Forgot password?
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Quick Order
Products
Antibodies
ELISA and Assay Kits
Research Areas
Infectious Disease
Resources
Purchasing
Reference Material
Contact Us
Location
Corporate Headquarters
Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States
Telephone Numbers
Customer Service: (800) 227-6666 / (650) 697-3600
Contact Us
Additional Contact Details
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Forgot password?
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Quick Order
| Catalog Number | Size | Price |
|---|---|---|
| LS-G136398-20 | 20 µg | $405 |
| LS-G136398-100 | 100 µg | $598 |
| LS-G136398-1 | 1 mg | $1,679 |
1 of 3
2 of 3
3 of 3
Bovine FDX1 / ADX Protein (Recombinant 10His, N-terminus) (Full Length) - LS-G136398
Bovine FDX1 / ADX Protein (Recombinant 10His, N-terminus) (Full Length) - LS-G136398
Description:
FDX1 / ADX Protein LS-G136398 is a Recombinant Bovine FDX1 / ADX produced in E. coli 59-186aa with 10His, N-terminus tag(s). For Research Use Only
Toll Free North America
(800) 227-6666
(800) 227-6666For Research Use Only
Overview
Description:
FDX1 / ADX Protein LS-G136398 is a Recombinant Bovine FDX1 / ADX produced in E. coli 59-186aa with 10His, N-terminus tag(s). For Research Use Only
Specifications
Type
Recombinant Protein
Target
FDX1 / ADX
Synonyms
FDX1 | Adrenodoxin | ADX | Ferredoxin-1 | Adrenal ferredoxin | Adrenodoxin, mitochondrial | Ferredoxin 1 | LOH11CR1D | FDX | Hepatoredoxin | Mitochondrial adrenodoxin
Species
Bovine
Modifications
Unmodified
Conjugations
Unconjugated
Tag
10His, N-terminus
Region
59-186aa
Predicted Molecular Weight
19.5 kDa
AA Sequence
SSSEDKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVPDAVSDARESIDMGMNSSKIE
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 85% by SDS-PAGE
Usage Summary
Essential for the synthesis of various steroid hormones, participates in the reduction of mitochondrial cytochrome P450 for steroidogenesis. Transfers electrons from adrenodoxin reductase to CYP11A1, a cytochrome P450 that catalyzes cholesterol side-chain cleavage (By similarity).
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
About FDX1 / ADX
Publications (0)
Customer Reviews (0)
Images
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Bovine Adrenodoxin, mitochondrial(FDX1) could indicate that this peptide derived from E.coli-expressed Bos taurus (Bovine) FDX1.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Bovine Adrenodoxin, mitochondrial(FDX1) could indicate that this peptide derived from E.coli-expressed Bos taurus (Bovine) FDX1.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Bovine Adrenodoxin, mitochondrial(FDX1) could indicate that this peptide derived from E.coli-expressed Bos taurus (Bovine) FDX1.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Bovine Adrenodoxin, mitochondrial(FDX1) could indicate that this peptide derived from E.coli-expressed Bos taurus (Bovine) FDX1.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Bovine Adrenodoxin, mitochondrial(FDX1) could indicate that this peptide derived from E.coli-expressed Bos taurus (Bovine) FDX1.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Bovine Adrenodoxin, mitochondrial(FDX1) could indicate that this peptide derived from E.coli-expressed Bos taurus (Bovine) FDX1.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Bovine Adrenodoxin, mitochondrial(FDX1) could indicate that this peptide derived from E.coli-expressed Bos taurus (Bovine) FDX1.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Bovine Adrenodoxin, mitochondrial(FDX1) could indicate that this peptide derived from E.coli-expressed Bos taurus (Bovine) FDX1.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Request SDS/MSDS
To request an SDS/MSDS form for this product, please contact our Technical Support department at:
Technical.Support@LSBio.com
Requested From: United States
Date Requested: 11/16/2024
Date Requested: 11/16/2024
