Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G137197-20 20 µg $405 
LS-G137197-100 100 µg $598 
LS-G137197-1 1 mg $1,679 
Abrin-a-like (Abrus precatorius) Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Abrin-a-like (Abrus precatorius) Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Abrus precatorius Abrin-a,partial could indicate that this peptide derived from E.coli-expressed Abrus precatorius (Indian licorice) (Glycine abrus) N/A.
Abrin-a-like (Abrus precatorius) Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Abrus precatorius Abrin-a,partial could indicate that this peptide derived from E.coli-expressed Abrus precatorius (Indian licorice) (Glycine abrus) N/A.
Abrin-a-like (Abrus precatorius) Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Abrin-a-like (Abrus precatorius) Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Abrus precatorius Abrin-a,partial could indicate that this peptide derived from E.coli-expressed Abrus precatorius (Indian licorice) (Glycine abrus) N/A.
Abrin-a-like (Abrus precatorius) Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Abrus precatorius Abrin-a,partial could indicate that this peptide derived from E.coli-expressed Abrus precatorius (Indian licorice) (Glycine abrus) N/A.
1 of 3
2 of 3
3 of 3

Abrin-a-like (Abrus precatorius) Protein (Recombinant 10His, N-terminus) - LS-G137197

Abrin-a-like (Abrus precatorius) Protein (Recombinant 10His, N-terminus) - LS-G137197

Description:
Abrin-a-like (Abrus precatorius) Protein LS-G137197 is a Recombinant Abrin-a-like (Abrus precatorius) produced in E. coli 1-251aa with 10His, N-terminus tag(s). For Research Use Only
Price
Catalog Number
$405
LS-G137197-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
Abrin-a-like (Abrus precatorius) Protein LS-G137197 is a Recombinant Abrin-a-like (Abrus precatorius) produced in E. coli 1-251aa with 10His, N-terminus tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
Abrin-a-like (Abrus precatorius)
Species
Abrus precatorius
Modifications
Unmodified
Conjugations
Unconjugated
Tag
10His, N-terminus
Region
1-251aa
Predicted Molecular Weight
33.6 kDa
AA Sequence
QDRPIKFSTEGATSQSYKQFIEALRERLRGGLIHDIPVLPDPTTLQERNRYITVELSNSDTESIEVGIDVTNAYVVAYRAGTQSYFLRDAPSSASDYLFTGTDQHSLPFYGTYGDLERWAHQSRQQIPLGLQALTHGISFFRSGGNDNEEKARTLIVIIQMVAEAARFRYISNRVRVSIQTGTAFQPDAAMISLENNWDNLSRGVQESVQDTFPNQVTLTNIRNEPVIVDSLSHPTVAVLALMLFVCNPPN
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 85% by SDS-PAGE
Usage Summary
The A chain is responsible for inhibiting protein synthesis through the catalytic inactivation of 60S ribosomal subunits by removing adenine from position 4,324 of 28S rRNA. Abrin-a is more toxic than ricin.; FUNCTION
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About Abrin-a-like (Abrus precatorius)
P11140

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Abrin-a-like (Abrus precatorius) Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

Abrin-a-like (Abrus precatorius) Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Abrus precatorius Abrin-a,partial could indicate that this peptide derived from E.coli-expressed Abrus precatorius (Indian licorice) (Glycine abrus) N/A.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Abrus precatorius Abrin-a,partial could indicate that this peptide derived from E.coli-expressed Abrus precatorius (Indian licorice) (Glycine abrus) N/A.

Mass Cytometry

Abrin-a-like (Abrus precatorius) Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Abrus precatorius Abrin-a,partial could indicate that this peptide derived from E.coli-expressed Abrus precatorius (Indian licorice) (Glycine abrus) N/A.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Abrus precatorius Abrin-a,partial could indicate that this peptide derived from E.coli-expressed Abrus precatorius (Indian licorice) (Glycine abrus) N/A.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Abrin-a-like (Abrus precatorius) Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

Abrin-a-like (Abrus precatorius) Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Abrus precatorius Abrin-a,partial could indicate that this peptide derived from E.coli-expressed Abrus precatorius (Indian licorice) (Glycine abrus) N/A.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Abrus precatorius Abrin-a,partial could indicate that this peptide derived from E.coli-expressed Abrus precatorius (Indian licorice) (Glycine abrus) N/A.

Mass Cytometry

Abrin-a-like (Abrus precatorius) Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Abrus precatorius Abrin-a,partial could indicate that this peptide derived from E.coli-expressed Abrus precatorius (Indian licorice) (Glycine abrus) N/A.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Abrus precatorius Abrin-a,partial could indicate that this peptide derived from E.coli-expressed Abrus precatorius (Indian licorice) (Glycine abrus) N/A.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Abrin-a-like (Abrus precatorius) Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

Abrin-a-like (Abrus precatorius) Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Abrus precatorius Abrin-a,partial could indicate that this peptide derived from E.coli-expressed Abrus precatorius (Indian licorice) (Glycine abrus) N/A.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Abrus precatorius Abrin-a,partial could indicate that this peptide derived from E.coli-expressed Abrus precatorius (Indian licorice) (Glycine abrus) N/A.

Mass Cytometry

Abrin-a-like (Abrus precatorius) Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Abrus precatorius Abrin-a,partial could indicate that this peptide derived from E.coli-expressed Abrus precatorius (Indian licorice) (Glycine abrus) N/A.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Abrus precatorius Abrin-a,partial could indicate that this peptide derived from E.coli-expressed Abrus precatorius (Indian licorice) (Glycine abrus) N/A.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Abrin-a-like (Abrus precatorius) Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

Abrin-a-like (Abrus precatorius) Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Abrus precatorius Abrin-a,partial could indicate that this peptide derived from E.coli-expressed Abrus precatorius (Indian licorice) (Glycine abrus) N/A.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Abrus precatorius Abrin-a,partial could indicate that this peptide derived from E.coli-expressed Abrus precatorius (Indian licorice) (Glycine abrus) N/A.

Mass Cytometry

Abrin-a-like (Abrus precatorius) Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Abrus precatorius Abrin-a,partial could indicate that this peptide derived from E.coli-expressed Abrus precatorius (Indian licorice) (Glycine abrus) N/A.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Abrus precatorius Abrin-a,partial could indicate that this peptide derived from E.coli-expressed Abrus precatorius (Indian licorice) (Glycine abrus) N/A.

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 10/1/2024