Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C662510-10 10 µg $318 
LS-C662510-100 100 µg $470 
YWHAZ / 14-3-3 Zeta Antibody - IHC analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody. 14-3-3 zeta/delta was detected in paraffin-embedded section of mouse small intestine tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-14-3-3 zeta/delta Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
YWHAZ / 14-3-3 Zeta Antibody - Immunohistochemistry - Anti-14-3-3 zeta/delta Picoband antibody
YWHAZ / 14-3-3 Zeta Antibody - Immunohistochemistry - Anti-14-3-3 zeta/delta Picoband antibody
YWHAZ / 14-3-3 Zeta Antibody - Immunohistochemistry - Anti-14-3-3 zeta/delta Picoband antibody
YWHAZ / 14-3-3 Zeta Antibody - Immunohistochemistry - Anti-14-3-3 zeta/delta Picoband antibody
YWHAZ / 14-3-3 Zeta Antibody - IF analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody 14-3-3 zeta/delta was detected in immunocytochemical section of A549 cell. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-14-3-3 zeta/delta Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
YWHAZ / 14-3-3 Zeta Antibody - IF analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody 14-3-3 zeta/delta was detected in immunocytochemical section of A431 cell. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-14-3-3 zeta/delta Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
YWHAZ / 14-3-3 Zeta Antibody - Western blot - Anti-14-3-3 zeta/delta Picoband antibody
YWHAZ / 14-3-3 Zeta Antibody - Western blot - Anti-14-3-3 zeta/delta Picoband antibody
YWHAZ / 14-3-3 Zeta Antibody - Flow Cytometry analysis of A431 cells using anti-YWHAZ antibody. Overlay histogram showing A431 cells stained with anti-YWHAZ antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-YWHAZ Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
YWHAZ / 14-3-3 Zeta Antibody - Flow Cytometry analysis of U20S cells using anti-YWHAZ antibody. Overlay histogram showing U20S cells stained with anti-YWHAZ antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-YWHAZ Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
YWHAZ / 14-3-3 Zeta Antibody - IHC analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody. 14-3-3 zeta/delta was detected in paraffin-embedded section of mouse small intestine tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-14-3-3 zeta/delta Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
YWHAZ / 14-3-3 Zeta Antibody - Immunohistochemistry - Anti-14-3-3 zeta/delta Picoband antibody
YWHAZ / 14-3-3 Zeta Antibody - Immunohistochemistry - Anti-14-3-3 zeta/delta Picoband antibody
YWHAZ / 14-3-3 Zeta Antibody - Immunohistochemistry - Anti-14-3-3 zeta/delta Picoband antibody
YWHAZ / 14-3-3 Zeta Antibody - Immunohistochemistry - Anti-14-3-3 zeta/delta Picoband antibody
YWHAZ / 14-3-3 Zeta Antibody - IF analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody 14-3-3 zeta/delta was detected in immunocytochemical section of A549 cell. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-14-3-3 zeta/delta Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
YWHAZ / 14-3-3 Zeta Antibody - IF analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody 14-3-3 zeta/delta was detected in immunocytochemical section of A431 cell. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-14-3-3 zeta/delta Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
YWHAZ / 14-3-3 Zeta Antibody - Western blot - Anti-14-3-3 zeta/delta Picoband antibody
YWHAZ / 14-3-3 Zeta Antibody - Western blot - Anti-14-3-3 zeta/delta Picoband antibody
YWHAZ / 14-3-3 Zeta Antibody - Flow Cytometry analysis of A431 cells using anti-YWHAZ antibody. Overlay histogram showing A431 cells stained with anti-YWHAZ antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-YWHAZ Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
YWHAZ / 14-3-3 Zeta Antibody - Flow Cytometry analysis of U20S cells using anti-YWHAZ antibody. Overlay histogram showing U20S cells stained with anti-YWHAZ antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-YWHAZ Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
1 of 11
2 of 11
3 of 11
4 of 11
5 of 11
6 of 11
7 of 11
8 of 11
9 of 11
10 of 11
11 of 11

Polyclonal Rabbit anti‑Human YWHAZ / 14‑3‑3 Zeta Antibody (IHC, WB) LS‑C662510

Polyclonal Rabbit anti‑Human YWHAZ / 14‑3‑3 Zeta Antibody (IHC, WB) LS‑C662510

Antibody:
YWHAZ / 14-3-3 Zeta Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C662510-10
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
YWHAZ / 14-3-3 Zeta Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
14-3-3 Zeta antibody LS-C662510 is an unconjugated rabbit polyclonal antibody to human 14-3-3 Zeta (YWHAZ). Validated for IHC and WB.
Target
Human YWHAZ / 14-3-3 Zeta
Synonyms
YWHAZ | 14-3-3 protein zeta/delta | 14-3-3-zeta | 14-3-3 delta | 14-3-3 protein zeta | 14-3-3 zeta | Phospholipase A2 | YWHAD | KCIP-1
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence of human 14-3-3 zeta/delta (LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ).
Applications
  • IHC
  • IHC - Paraffin
  • Western blot
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Presentation
Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About YWHAZ / 14-3-3 Zeta
P63104 NM_003406 NP_003397.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 7/17/2024