Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C756540-10 10 µg $318 
LS-C756540-100 100 µg $470 
UBE2I / UBC9 Antibody - IHC analysis of UBE2I UBC9 using anti-UBE2I UBC9 antibody. UBE2I UBC9 was detected in paraffin-embedded section of mouse brain tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-UBE2I UBC9 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
UBE2I / UBC9 Antibody - IHC analysis of UBE2I UBC9 using anti-UBE2I UBC9 antibody. UBE2I UBC9 was detected in paraffin-embedded section of human placenta tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-UBE2I UBC9 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
UBE2I / UBC9 Antibody - IHC analysis of UBE2I UBC9 using anti-UBE2I UBC9 antibody. UBE2I UBC9 was detected in paraffin-embedded section of human lung cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-UBE2I UBC9 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
UBE2I / UBC9 Antibody - IHC analysis of UBE2I UBC9 using anti-UBE2I UBC9 antibody. UBE2I UBC9 was detected in paraffin-embedded section of rat brain tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-UBE2I UBC9 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
UBE2I / UBC9 Antibody - IHC analysis of UBE2I UBC9 using anti-UBE2I UBC9 antibody. UBE2I UBC9 was detected in paraffin-embedded section of human glioma tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-UBE2I UBC9 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
UBE2I / UBC9 Antibody - IHC analysis of UBE2I UBC9 using anti-UBE2I UBC9 antibody. UBE2I UBC9 was detected in paraffin-embedded section of human gastric cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-UBE2I UBC9 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
UBE2I / UBC9 Antibody - IHC analysis of UBE2I UBC9 using anti-UBE2I UBC9 antibody. UBE2I UBC9 was detected in paraffin-embedded section of rat lung tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-UBE2I UBC9 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
UBE2I / UBC9 Antibody - IHC analysis of UBE2I/UBC9 using anti-UBE2I/UBC9 antibody. UBE2I/UBC9 was detected in paraffin-embedded section of human tonsil tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-UBE2I/UBC9 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
UBE2I / UBC9 Antibody - IHC analysis of UBE2I/UBC9 using anti-UBE2I/UBC9 antibody. UBE2I/UBC9 was detected in paraffin-embedded section of human thyroid cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-UBE2I/UBC9 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
UBE2I / UBC9 Antibody - IHC analysis of UBE2I/UBC9 using anti-UBE2I/UBC9 antibody. UBE2I/UBC9 was detected in paraffin-embedded section of human rectal cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-UBE2I/UBC9 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
UBE2I / UBC9 Antibody - IHC analysis of UBE2I/UBC9 using anti-UBE2I/UBC9 antibody. UBE2I/UBC9 was detected in paraffin-embedded section of mouse intestine tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-UBE2I/UBC9 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
UBE2I / UBC9 Antibody - IHC analysis of UBE2I UBC9 using anti-UBE2I UBC9 antibody. UBE2I UBC9 was detected in paraffin-embedded section of human appendicitis tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-UBE2I UBC9 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
UBE2I / UBC9 Antibody - IHC analysis of UBE2I/UBC9 using anti-UBE2I/UBC9 antibody. UBE2I/UBC9 was detected in paraffin-embedded section of rat intestine tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-UBE2I/UBC9 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
UBE2I / UBC9 Antibody - IHC analysis of UBE2I/UBC9 using anti-UBE2I/UBC9 antibody. UBE2I/UBC9 was detected in paraffin-embedded section of mouse lung tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-UBE2I/UBC9 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
UBE2I / UBC9 Antibody - IF analysis of UBE2I/UBC9 using anti-UBE2I/UBC9 antibody UBE2I/UBC9 was detected in immunocytochemical section of U20S cell. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-UBE2I/UBC9 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
UBE2I / UBC9 Antibody - Western blot analysis of UBE2I UBC9 using anti-UBE2I UBC9 antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human K562 whole cell lysate,Lane 2: human HepG2 whole cell lysate,Lane 3: rat kidney tissue lysates,Lane 4: rat spleen tissue lysates,Lane 5: rat ovary tissue lysates,Lane 6: mouse spleen tissue lysates,Lane 7: mouse ovary tissue lysates,Lane 8: mouse liver tissue lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-UBE2I UBC9 antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for UBE2I UBC9 at approximately 18KD. The expected band size for UBE2I UBC9 is at 18KD.
UBE2I / UBC9 Antibody - IHC analysis of UBE2I UBC9 using anti-UBE2I UBC9 antibody. UBE2I UBC9 was detected in paraffin-embedded section of mouse brain tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-UBE2I UBC9 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
UBE2I / UBC9 Antibody - IHC analysis of UBE2I UBC9 using anti-UBE2I UBC9 antibody. UBE2I UBC9 was detected in paraffin-embedded section of human placenta tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-UBE2I UBC9 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
UBE2I / UBC9 Antibody - IHC analysis of UBE2I UBC9 using anti-UBE2I UBC9 antibody. UBE2I UBC9 was detected in paraffin-embedded section of human lung cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-UBE2I UBC9 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
UBE2I / UBC9 Antibody - IHC analysis of UBE2I UBC9 using anti-UBE2I UBC9 antibody. UBE2I UBC9 was detected in paraffin-embedded section of rat brain tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-UBE2I UBC9 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
UBE2I / UBC9 Antibody - IHC analysis of UBE2I UBC9 using anti-UBE2I UBC9 antibody. UBE2I UBC9 was detected in paraffin-embedded section of human glioma tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-UBE2I UBC9 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
UBE2I / UBC9 Antibody - IHC analysis of UBE2I UBC9 using anti-UBE2I UBC9 antibody. UBE2I UBC9 was detected in paraffin-embedded section of human gastric cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-UBE2I UBC9 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
UBE2I / UBC9 Antibody - IHC analysis of UBE2I UBC9 using anti-UBE2I UBC9 antibody. UBE2I UBC9 was detected in paraffin-embedded section of rat lung tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-UBE2I UBC9 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
UBE2I / UBC9 Antibody - IHC analysis of UBE2I/UBC9 using anti-UBE2I/UBC9 antibody. UBE2I/UBC9 was detected in paraffin-embedded section of human tonsil tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-UBE2I/UBC9 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
UBE2I / UBC9 Antibody - IHC analysis of UBE2I/UBC9 using anti-UBE2I/UBC9 antibody. UBE2I/UBC9 was detected in paraffin-embedded section of human thyroid cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-UBE2I/UBC9 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
UBE2I / UBC9 Antibody - IHC analysis of UBE2I/UBC9 using anti-UBE2I/UBC9 antibody. UBE2I/UBC9 was detected in paraffin-embedded section of human rectal cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-UBE2I/UBC9 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
UBE2I / UBC9 Antibody - IHC analysis of UBE2I/UBC9 using anti-UBE2I/UBC9 antibody. UBE2I/UBC9 was detected in paraffin-embedded section of mouse intestine tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-UBE2I/UBC9 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
UBE2I / UBC9 Antibody - IHC analysis of UBE2I UBC9 using anti-UBE2I UBC9 antibody. UBE2I UBC9 was detected in paraffin-embedded section of human appendicitis tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-UBE2I UBC9 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
UBE2I / UBC9 Antibody - IHC analysis of UBE2I/UBC9 using anti-UBE2I/UBC9 antibody. UBE2I/UBC9 was detected in paraffin-embedded section of rat intestine tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-UBE2I/UBC9 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
UBE2I / UBC9 Antibody - IHC analysis of UBE2I/UBC9 using anti-UBE2I/UBC9 antibody. UBE2I/UBC9 was detected in paraffin-embedded section of mouse lung tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-UBE2I/UBC9 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
UBE2I / UBC9 Antibody - IF analysis of UBE2I/UBC9 using anti-UBE2I/UBC9 antibody UBE2I/UBC9 was detected in immunocytochemical section of U20S cell. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-UBE2I/UBC9 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
UBE2I / UBC9 Antibody - Western blot analysis of UBE2I UBC9 using anti-UBE2I UBC9 antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human K562 whole cell lysate,Lane 2: human HepG2 whole cell lysate,Lane 3: rat kidney tissue lysates,Lane 4: rat spleen tissue lysates,Lane 5: rat ovary tissue lysates,Lane 6: mouse spleen tissue lysates,Lane 7: mouse ovary tissue lysates,Lane 8: mouse liver tissue lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-UBE2I UBC9 antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for UBE2I UBC9 at approximately 18KD. The expected band size for UBE2I UBC9 is at 18KD.
1 of 16
2 of 16
3 of 16
4 of 16
5 of 16
6 of 16
7 of 16
8 of 16
9 of 16
10 of 16
11 of 16
12 of 16
13 of 16
14 of 16
15 of 16
16 of 16

Polyclonal Rabbit anti‑Human UBE2I / UBC9 Antibody (IHC, WB) LS‑C756540

Polyclonal Rabbit anti‑Human UBE2I / UBC9 Antibody (IHC, WB) LS‑C756540

Antibody:
UBE2I / UBC9 Rabbit anti-Human Polyclonal Antibody
Application:
IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C756540-10
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
UBE2I / UBC9 Rabbit anti-Human Polyclonal Antibody
Application:
IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
UBC9 antibody LS-C756540 is an unconjugated rabbit polyclonal antibody to UBC9 (UBE2I) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Target
Human UBE2I / UBC9
Synonyms
UBE2I | C358B7.1 | SUMO-conjugating enzyme UBC9 | UBC9 | SUMO-protein ligase | UBCE9 | Ubiquitin carrier protein 9 | Ubiquitin carrier protein I | Ubiquitin-protein ligase I | p18 | SUMO-1-protein ligase | Ubiquitin conjugating enzyme 9 | Ubiquitin-protein ligase E2I
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence of human UBE2I UBC9 (NIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAPS).
Specificity
No cross reactivity with other proteins.
Applications
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
Applications should be user optimized.
Presentation
Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
After reconstitution, may be stored at 4°C for 1 month. For long-term storage and to avoid freeze-thaw cycles, aliquot and store at -20°C.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About UBE2I / UBC9
P63279 NM_003345 NP_003336.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 7/17/2024