LSBio logo with text
Products
Research Areas
COVID-19
Resources
Contact Us
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Cart
How To Buy
Contact Us

Locations

Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers


Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us


Additional Contact Details

Distributors
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Antibodies > TCP1 > LS-C756653
 
Print Page  
Catalog Number Size Price
LS-C756653-10 10 µg $318 
LS-C756653-100 100 µg $470 
TCP1 Antibody - IHC analysis of TCP1 alpha using anti-TCP1 alpha antibody. TCP1 alpha was detected in paraffin-embedded section of human placenta tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/ml mouse anti-TCP1 alpha Antibody overnight at 4°C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
TCP1 Antibody - IHC analysis of TCP1 alpha using anti-TCP1 alpha antibody. TCP1 alpha was detected in paraffin-embedded section of human lung cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/ml mouse anti-TCP1 alpha Antibody overnight at 4°C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
TCP1 Antibody - Western blot analysis of TCP1 alpha using anti-TCP1 alpha antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human Hela whole cell lysates, Lane 2: human MCF-7 whole cell lysates, Lane 3: human COLO-320 whole cell lysates, Lane 4: human HepG2 whole cell lysates, Lane 5: human A431 whole cell lysates, Lane 6: human HT1080 whole cell lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-TCP1 alpha antigen affinity purified monoclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a Biotin Conjugated goat anti-mouse IgG secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system.
TCP1 Antibody - Flow Cytometry analysis of HepG2 cells using anti-TCP1 alpha antibody. Overlay histogram showing HepG2 cells stained with anti-TCP1 alpha antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-TCP1 alpha Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-mouse IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
TCP1 Antibody - IHC analysis of TCP1 alpha using anti-TCP1 alpha antibody. TCP1 alpha was detected in paraffin-embedded section of human placenta tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/ml mouse anti-TCP1 alpha Antibody overnight at 4°C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
TCP1 Antibody - IHC analysis of TCP1 alpha using anti-TCP1 alpha antibody. TCP1 alpha was detected in paraffin-embedded section of human lung cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/ml mouse anti-TCP1 alpha Antibody overnight at 4°C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
TCP1 Antibody - Western blot analysis of TCP1 alpha using anti-TCP1 alpha antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human Hela whole cell lysates, Lane 2: human MCF-7 whole cell lysates, Lane 3: human COLO-320 whole cell lysates, Lane 4: human HepG2 whole cell lysates, Lane 5: human A431 whole cell lysates, Lane 6: human HT1080 whole cell lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-TCP1 alpha antigen affinity purified monoclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a Biotin Conjugated goat anti-mouse IgG secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system.
TCP1 Antibody - Flow Cytometry analysis of HepG2 cells using anti-TCP1 alpha antibody. Overlay histogram showing HepG2 cells stained with anti-TCP1 alpha antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-TCP1 alpha Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-mouse IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
1 of 4
2 of 4
3 of 4
4 of 4

Monoclonal Mouse anti‑Human TCP1 Antibody (IHC, WB) LS‑C756653

Monoclonal Mouse anti‑Human TCP1 Antibody (IHC, WB) LS‑C756653

Submit Review LSBio Guarantee
Antibody:
TCP1 Mouse anti-Human Monoclonal Antibody
Application:
IHC-P, IHC-Fr, ICC, WB, Flo
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C756653-10
Toll Free North America
206-374-1102
For Research Use Only
Specifications Validation Publications Reviews Featured Products Request SDS/MSDS

Overview

Antibody:
TCP1 Mouse anti-Human Monoclonal Antibody
Application:
IHC-P, IHC-Fr, ICC, WB, Flo
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
TCP1 antibody LS-C756653 is an unconjugated mouse monoclonal antibody to human TCP1. Validated for Flow, ICC, IHC and WB.
Target
Human TCP1
Synonyms
TCP1 | CCTA | CCT-alpha | D6S230E | T-complex 1 | TCP-1-alpha | Tailless complex polypeptide 1 | CCT1
Host
Mouse
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
IgG1 Monoclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence at the C-Terminus of human TCP1 alpha (515-551 aa KFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHS), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.
Specificity
No cross reactivity with other proteins.
Applications
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • IHC - Frozen (0.5 - 1 µg/ml)
  • ICC (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
  • Flow Cytometry (1 - 3 µg/10E6 cells)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
Applications should be user optimized.
Presentation
Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
After reconstitution, may be stored at 4°C for 1 month. For long-term storage and to avoid freeze-thaw cycles, aliquot and store at -20°C.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About TCP1
P17987 NM_030752 NP_110379.2

Publications (0)

Submit a Publication for LS-C756653

Customer Reviews (0)

Submit a review for LS-C756653

Featured Products

Product
TCP1 Antibody (C‑Terminus, clone 91a) LS‑C63149
Species: Mouse, Human, Monkey, Rat, Bovine, Dog, Guinea pig, Hamster, Pig, Drosophila, C. elegans, Plant
Applications: Western blot, Immunoprecipitation, Flow Cytometry
TCP1 Antibody - Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC‑plus™ TCP1 Antibody LS‑B14875
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot
Product
TCP1 Antibody (C‑Terminus, clone 91a, Atto 390) LS‑C230196
Species: Mouse, Human, Monkey, Rat, Bovine, Dog, Guinea pig, Hamster, Pig, Rabbit, Yeast, C. elegans, Fruit fly
Applications: IHC, Western blot, Immunoprecipitation, Flow Cytometry
PACAP ELISA Kit
Human PACAP (Competitive EIA) ELISA Kit - LS-F9730
Reactivity: Human
Range: 6.17-500 pg/ml
Product
Mouse Anti‑Human IgG4 Secondary Antibody (clone HP6025, HRP) LS‑C57669
Species: Human
Applications: IHC, IHC - Frozen, ELISA
PTGS2 / COX2 / COX-2 ELISA Kit
Human PTGS2 / COX2 / COX-2 (Sandwich ELISA) ELISA Kit - LS-F4834
Reactivity: Human
Range: 0.312-20 ng/ml
See all TCP1 Antibodies

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com
Requested From: United States
Date Requested: 7/17/2024
Family of Companies
Site Links Home All Antibodies How To Buy All Proteins Distributors All ELISA & Assay Kits Reviews PathPlus™ Antibodies
Follow LSBio View Cart Register or Login
Copyright © 2024 LifeSpan BioSciences, Inc - Privacy Policy
Contact Us

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

To place an order:
Orders@LSBio.com

For questions about orders:
Customer.Support@LSBio.com

For technical assistance:
Technical.Support@LSBio.com