LSBio logo with text
Products
Research Areas
COVID-19
Resources
Contact Us
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Cart
How To Buy
Contact Us

Locations

Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers


Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us


Additional Contact Details

Distributors
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Antibodies > SUB1 > LS-C662379
 
Print Page  
Catalog Number Size Price
LS-C662379-10 10 µg $318 
LS-C662379-100 100 µg $470 
SUB1 Antibody - IHC analysis of PC4 using anti-PC4 antibody. PC4 was detected in paraffin-embedded section of rat liver tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-PC4 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
SUB1 Antibody - PC4 was detected in paraffin-embedded sections of human mammary cancer tissues using rabbit anti- PC4 Antigen Affinity purified polyclonal antibody
SUB1 Antibody - PC4 was detected in paraffin-embedded sections of mouse liver tissues using rabbit anti- PC4 Antigen Affinity purified polyclonal antibody
SUB1 Antibody - Western blot analysis of PC4 using anti-PC4 antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat liver tissue lysates, Lane 2: Hela whole cell lysates, Lane 3: U2OS whole cell lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-PC4 antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for PC4 at approximately 19KD. The expected band size for PC4 is at 19KD.
SUB1 Antibody - Flow Cytometry analysis of U87 cells using anti-PC4 antibody. Overlay histogram showing U87 cells stained with anti-PC4 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PC4 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
SUB1 Antibody - Flow Cytometry analysis of A431 cells using anti-PC4 antibody. Overlay histogram showing A431 cells stained with anti-PC4 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PC4 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
SUB1 Antibody - IHC analysis of PC4 using anti-PC4 antibody. PC4 was detected in paraffin-embedded section of rat liver tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-PC4 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
SUB1 Antibody - PC4 was detected in paraffin-embedded sections of human mammary cancer tissues using rabbit anti- PC4 Antigen Affinity purified polyclonal antibody
SUB1 Antibody - PC4 was detected in paraffin-embedded sections of mouse liver tissues using rabbit anti- PC4 Antigen Affinity purified polyclonal antibody
SUB1 Antibody - Western blot analysis of PC4 using anti-PC4 antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat liver tissue lysates, Lane 2: Hela whole cell lysates, Lane 3: U2OS whole cell lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-PC4 antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for PC4 at approximately 19KD. The expected band size for PC4 is at 19KD.
SUB1 Antibody - Flow Cytometry analysis of U87 cells using anti-PC4 antibody. Overlay histogram showing U87 cells stained with anti-PC4 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PC4 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
SUB1 Antibody - Flow Cytometry analysis of A431 cells using anti-PC4 antibody. Overlay histogram showing A431 cells stained with anti-PC4 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PC4 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
1 of 6
2 of 6
3 of 6
4 of 6
5 of 6
6 of 6

Polyclonal Rabbit anti‑Human SUB1 Antibody (IHC, WB) LS‑C662379

Polyclonal Rabbit anti‑Human SUB1 Antibody (IHC, WB) LS‑C662379

Submit Review LSBio Guarantee
Antibody:
SUB1 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C662379-10
Toll Free North America
206-374-1102
For Research Use Only
Specifications Validation Publications Reviews Featured Products Request SDS/MSDS

Overview

Antibody:
SUB1 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
SUB1 antibody LS-C662379 is an unconjugated rabbit polyclonal antibody to human SUB1. Validated for IHC and WB.
Target
Human SUB1
Synonyms
SUB1 | p15 | p14 | PC4 | Positive cofactor 4 | RPO2TC1 | SUB1 homolog | SUB1 homolog (S. cerevisiae)
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence at the C-Terminus of human PC4 (96-127 aa MKPGRKGISLNPEQWSQLKEQISDIDDAVRKL), different from the related mouse and rat sequences by one amino acid.
Applications
  • IHC
  • IHC - Paraffin
  • Western blot
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Presentation
Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About SUB1
NM_006713 NP_006704.3

Publications (0)

Submit a Publication for LS-C662379

Customer Reviews (0)

Submit a review for LS-C662379

Featured Products

SUB1 Antibody - Immunohistochemistry of paraffin-embedded human stomach tissue.
SUB1 Antibody LS‑C346215
Species: Human, Mouse
Applications: IHC, Immunofluorescence, Western blot, Immunoprecipitation
SUB1 Antibody - Immunohistochemical analysis of PC4 staining in human stomach formalin fixed paraffin embedded tissue section. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH 6.0). The section was then incubated with the antibody at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with hematoxylin and mounted with DPX.
SUB1 Antibody LS‑C482765
Species: Human, Mouse
Applications: IHC, IHC - Paraffin, ICC, Immunofluorescence, Western blot
SUB1 Antibody - SUB1 antibody P100960_T100-NP_006704-PC4 Antibody was used in IHC to stain formalin-fixed, paraffin-embedded human liver. This image was taken for the unconjugated form of this product. Other forms have not been tested.
SUB1 Antibody (aa62‑111) LS‑C30563
Species: Human
Applications: IHC, IHC - Paraffin, Western blot
SUB1 Protein
Human SUB1 Protein (Recombinant His) - LS-G795
Source: E. coli
Tag: His
ABCA4 ELISA Kit
Mouse ABCA4 (Sandwich ELISA) ELISA Kit - LS-F74200
Reactivity: Mouse
Range: 78-5000 pg/ml
TSLP Antibody - Human Breast Tubules: Formalin-Fixed, Paraffin-Embedded (FFPE)
TSLP Antibody LS‑B3208
Species: Human, Mouse
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, ELISA
See all SUB1 Antibodies

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com
Requested From: United States
Date Requested: 7/17/2024
Family of Companies
Site Links Home All Antibodies How To Buy All Proteins Distributors All ELISA & Assay Kits Reviews PathPlus™ Antibodies
Follow LSBio View Cart Register or Login
Copyright © 2024 LifeSpan BioSciences, Inc - Privacy Policy
Contact Us

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

To place an order:
Orders@LSBio.com

For questions about orders:
Customer.Support@LSBio.com

For technical assistance:
Technical.Support@LSBio.com