Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Location


Corporate Headquarters

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Telephone Numbers



Customer Service: (800) 227-6666 / (650) 697-3600


Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C407957-100 100 µg $470 
SLC10A1 / NTCP Antibody - SLC10A1 antibody IHC-paraffin. IHC(P): Human Liver Cancer Tissue.
SLC10A1 / NTCP Antibody - IHC analysis of SLC10A1 using anti-SLC10A1 antibody. SLC10A1 was detected in frozen section of mouse liver tissue . Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-SLC10A1 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
SLC10A1 / NTCP Antibody - SLC10A1 antibody IHC-paraffin. IHC(P): Mouse Liver Tissue.
SLC10A1 / NTCP Antibody - SLC10A1 antibody IHC-paraffin. IHC(P): Rat Liver Tissue.
SLC10A1 / NTCP Antibody - IF analysis of SLC10A1 using anti-SLC10A1 antibody. SLC10A1 was detected in paraffin-embedded section of mouse liver tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution ) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/mL rabbit anti-SLC10A1 Antibody overnight at 4°C. DyLight®550 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
SLC10A1 / NTCP Antibody - IF analysis of SLC10A1 using anti-SLC10A1 antibody. SLC10A1 was detected in paraffin-embedded section of mouse liver tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/mL rabbit anti-SLC10A1 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
SLC10A1 / NTCP Antibody - Western blot analysis of SLC10A1 using anti-SLC10A1 antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat liver tissue lysates, Lane 2: mouse liver tissue lysates, After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-SLC10A1 antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for SLC10A1 at approximately 50KD. The expected band size for SLC10A1 is at 38KD.
SLC10A1 / NTCP Antibody - Western blot analysis of SLC10A1 using anti-SLC10A1 antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat liver tissue lysates (positive control), Lane 2: rat kidney tissue lysates, (negative control) After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-SLC10A1 antigen affinity purified polyclonal antibody at 0.25 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for SLC10A1 at approximately 50KD. The expected band size for SLC10A1 is at 38KD.
SLC10A1 / NTCP Antibody - SLC10A1 antibody Western blot. All lanes: Anti SLC10A1 at 0.5 ug/ml. Lane 1: Rat Liver Tissue Lysate at 50 ug. Lane 2: Mouse Liver Tissue Lysate at 50 ug. Predicted band size: 45, 50 kD. Observed band size: 45, 50 kD.
SLC10A1 / NTCP Antibody - Flow Cytometry analysis of BRL cells using anti-SLC10A1 antibody. Overlay histogram showing BRL cells stained with anti-SLC10A1 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-SLC10A1 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
SLC10A1 / NTCP Antibody - SLC10A1 antibody IHC-paraffin. IHC(P): Human Liver Cancer Tissue.
SLC10A1 / NTCP Antibody - IHC analysis of SLC10A1 using anti-SLC10A1 antibody. SLC10A1 was detected in frozen section of mouse liver tissue . Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-SLC10A1 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
SLC10A1 / NTCP Antibody - SLC10A1 antibody IHC-paraffin. IHC(P): Mouse Liver Tissue.
SLC10A1 / NTCP Antibody - SLC10A1 antibody IHC-paraffin. IHC(P): Rat Liver Tissue.
SLC10A1 / NTCP Antibody - IF analysis of SLC10A1 using anti-SLC10A1 antibody. SLC10A1 was detected in paraffin-embedded section of mouse liver tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution ) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/mL rabbit anti-SLC10A1 Antibody overnight at 4°C. DyLight®550 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
SLC10A1 / NTCP Antibody - IF analysis of SLC10A1 using anti-SLC10A1 antibody. SLC10A1 was detected in paraffin-embedded section of mouse liver tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/mL rabbit anti-SLC10A1 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
SLC10A1 / NTCP Antibody - Western blot analysis of SLC10A1 using anti-SLC10A1 antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat liver tissue lysates, Lane 2: mouse liver tissue lysates, After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-SLC10A1 antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for SLC10A1 at approximately 50KD. The expected band size for SLC10A1 is at 38KD.
SLC10A1 / NTCP Antibody - Western blot analysis of SLC10A1 using anti-SLC10A1 antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat liver tissue lysates (positive control), Lane 2: rat kidney tissue lysates, (negative control) After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-SLC10A1 antigen affinity purified polyclonal antibody at 0.25 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for SLC10A1 at approximately 50KD. The expected band size for SLC10A1 is at 38KD.
SLC10A1 / NTCP Antibody - SLC10A1 antibody Western blot. All lanes: Anti SLC10A1 at 0.5 ug/ml. Lane 1: Rat Liver Tissue Lysate at 50 ug. Lane 2: Mouse Liver Tissue Lysate at 50 ug. Predicted band size: 45, 50 kD. Observed band size: 45, 50 kD.
SLC10A1 / NTCP Antibody - Flow Cytometry analysis of BRL cells using anti-SLC10A1 antibody. Overlay histogram showing BRL cells stained with anti-SLC10A1 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-SLC10A1 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
1 of 10
2 of 10
3 of 10
4 of 10
5 of 10
6 of 10
7 of 10
8 of 10
9 of 10
10 of 10

Polyclonal Rabbit anti‑Mouse SLC10A1 / NTCP Antibody (aa296‑336, IHC, WB) LS‑C407957

Polyclonal Rabbit anti‑Mouse SLC10A1 / NTCP Antibody (aa296‑336, IHC, WB) LS‑C407957

Antibody:
SLC10A1 / NTCP Rabbit anti-Mouse Polyclonal (aa296-336) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$470
LS-C407957-100
Toll Free North America
(800) 227-6666
For Research Use Only

Overview

Antibody:
SLC10A1 / NTCP Rabbit anti-Mouse Polyclonal (aa296-336) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
NTCP antibody LS-C407957 is an unconjugated rabbit polyclonal antibody to NTCP (SLC10A1) (aa296-336) from mouse. It is reactive with mouse and rat. Validated for IHC and WB.
Target
Mouse SLC10A1 / NTCP
Synonyms
SLC10A1 | Growth-inhibiting protein 29 | Na(+)/bile acid cotransporter | Sodium/bile acid cotransporter | Na+/bile acid cotransporter | NTCP | NTCP1
Host
Rabbit
Reactivity
Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence at the C-Terminus of mouse SLC10A1 (296-336 aa EGLLFIIIFRCYLKIKPQKDQTKITYKAAATEDATPAALEK), different from the related human sequence by eighteen amino acids, and from the related rat sequence by three amino acids
Epitope
aa296-336
Applications
  • IHC
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Presentation
Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About SLC10A1 / NTCP
Q14973 NM_003049 NP_003040.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 4/2/2025