Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Location


Corporate Headquarters

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Telephone Numbers



Customer Service: (800) 227-6666 / (650) 697-3600


Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C756591-10 10 µg $318 
LS-C756591-100 100 µg $470 
RXFP2 / LGR8 Antibody - Western blot analysis of GPCR LGR8 using anti-GPCR LGR8 antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human SHG-44 whole cell lysate. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-GPCR LGR8 antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for GPCR LGR8 at approximately 86KD. The expected band size for GPCR LGR8 is at 86KD.
RXFP2 / LGR8 Antibody - Flow Cytometry analysis of U251 cells using anti-GPCR LGR8 antibody. Overlay histogram showing U251 cells stained with anti-GPCR LGR8 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-GPCR LGR8 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
RXFP2 / LGR8 Antibody - Western blot analysis of GPCR LGR8 using anti-GPCR LGR8 antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human SHG-44 whole cell lysate. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-GPCR LGR8 antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for GPCR LGR8 at approximately 86KD. The expected band size for GPCR LGR8 is at 86KD.
RXFP2 / LGR8 Antibody - Flow Cytometry analysis of U251 cells using anti-GPCR LGR8 antibody. Overlay histogram showing U251 cells stained with anti-GPCR LGR8 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-GPCR LGR8 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
1 of 2
2 of 2

Polyclonal Rabbit anti‑Human RXFP2 / LGR8 Antibody (IHC, WB) LS‑C756591

Polyclonal Rabbit anti‑Human RXFP2 / LGR8 Antibody (IHC, WB) LS‑C756591

Antibody:
RXFP2 / LGR8 Rabbit anti-Human Polyclonal Antibody
Application:
IHC-Fr, ICC, WB, Flo
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C756591-10
Toll Free North America
(800) 227-6666
For Research Use Only

Overview

Antibody:
RXFP2 / LGR8 Rabbit anti-Human Polyclonal Antibody
Application:
IHC-Fr, ICC, WB, Flo
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
LGR8 antibody LS-C756591 is an unconjugated rabbit polyclonal antibody to human LGR8 (RXFP2). Validated for Flow, ICC, IHC and WB.
Target
Human RXFP2 / LGR8
Synonyms
RXFP2 | G-protein coupled receptor 106 | GPR106 | INSL3R | LGR8 | GREAT | Relaxin receptor 2 | LGR8.1 | RXFPR2
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence of human GPCR LGR8 (MIVFLVFKHLFSLRLITMFFLLHFIVLINVKDFALTQ).
Specificity
No cross reactivity with other proteins.
Applications
  • IHC - Frozen (0.5 - 1 µg/ml)
  • ICC (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
  • Flow Cytometry (1 - 3 µg/10E6 cells)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
Applications should be user optimized.
Presentation
Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
After reconstitution, may be stored at 4°C for 1 month. For long-term storage and to avoid freeze-thaw cycles, aliquot and store at -20°C.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About RXFP2 / LGR8
Q8WXD0 NM_130806 NP_570718.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 11/22/2024