LSBio logo with text
Products
Research Areas
COVID-19
Resources
Contact Us
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Cart
How To Buy
Contact Us

Location

Corporate Headquarters

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Telephone Numbers


Customer Service: (800) 227-6666 / (650) 697-3600


Contact Us


Additional Contact Details

Distributors
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Antibodies > Properdin / CFP > LS-C756429
 
Print Page  
Catalog Number Size Price
LS-C756429-10 10 µg $318 
LS-C756429-100 100 µg $470 
Properdin / CFP Antibody - IHC analysis of CFP using anti-CFP antibody. CFP was detected in paraffin-embedded section of mouse kidney tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-CFP Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
Properdin / CFP Antibody - IHC analysis of CFP using anti-CFP antibody. CFP was detected in paraffin-embedded section of rat liver tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-CFP Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
Properdin / CFP Antibody - IHC analysis of CFP using anti-CFP antibody. CFP was detected in paraffin-embedded section of rat intestine tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-CFP Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
Properdin / CFP Antibody - IHC analysis of CFP using anti-CFP antibody. CFP was detected in paraffin-embedded section of human cholangiocarcinoma tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-CFP Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
Properdin / CFP Antibody - IHC analysis of CFP using anti-CFP antibody. CFP was detected in paraffin-embedded section of human liver cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-CFP Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
Properdin / CFP Antibody - IHC analysis of CFP using anti-CFP antibody. CFP was detected in paraffin-embedded section of human placenta tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-CFP Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
Properdin / CFP Antibody - Western blot analysis of CFP using anti-CFP antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human placenta tissue lysates,Lane 2: human U-937 whole cell lysate,Lane 3: rat brain tissue lysates,Lane 4: mouse brain tissue lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-CFP antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for CFP at approximately 51KD. The expected band size for CFP is at 51KD.
Properdin / CFP Antibody - Flow Cytometry analysis of THP-1 cells using anti-CFP antibody. Overlay histogram showing THP-1 cells stained with anti-CFP antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CFP Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Properdin / CFP Antibody - IHC analysis of CFP using anti-CFP antibody. CFP was detected in paraffin-embedded section of mouse kidney tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-CFP Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
Properdin / CFP Antibody - IHC analysis of CFP using anti-CFP antibody. CFP was detected in paraffin-embedded section of rat liver tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-CFP Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
Properdin / CFP Antibody - IHC analysis of CFP using anti-CFP antibody. CFP was detected in paraffin-embedded section of rat intestine tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-CFP Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
Properdin / CFP Antibody - IHC analysis of CFP using anti-CFP antibody. CFP was detected in paraffin-embedded section of human cholangiocarcinoma tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-CFP Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
Properdin / CFP Antibody - IHC analysis of CFP using anti-CFP antibody. CFP was detected in paraffin-embedded section of human liver cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-CFP Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
Properdin / CFP Antibody - IHC analysis of CFP using anti-CFP antibody. CFP was detected in paraffin-embedded section of human placenta tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-CFP Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
Properdin / CFP Antibody - Western blot analysis of CFP using anti-CFP antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human placenta tissue lysates,Lane 2: human U-937 whole cell lysate,Lane 3: rat brain tissue lysates,Lane 4: mouse brain tissue lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-CFP antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for CFP at approximately 51KD. The expected band size for CFP is at 51KD.
Properdin / CFP Antibody - Flow Cytometry analysis of THP-1 cells using anti-CFP antibody. Overlay histogram showing THP-1 cells stained with anti-CFP antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CFP Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
1 of 8
2 of 8
3 of 8
4 of 8
5 of 8
6 of 8
7 of 8
8 of 8

Polyclonal Rabbit anti‑Human Properdin / CFP Antibody (IHC, WB) LS‑C756429

Polyclonal Rabbit anti‑Human Properdin / CFP Antibody (IHC, WB) LS‑C756429

Submit Review LSBio Guarantee
Antibody:
Properdin / CFP Rabbit anti-Human Polyclonal Antibody
Application:
IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C756429-10
Toll Free North America
(800) 227-6666
For Research Use Only
Specifications Validation Publications Reviews Featured Products Request SDS/MSDS

Overview

Antibody:
Properdin / CFP Rabbit anti-Human Polyclonal Antibody
Application:
IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
CFP antibody LS-C756429 is an unconjugated rabbit polyclonal antibody to CFP (Properdin) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Target
Human Properdin / CFP
Synonyms
CFP | Complement factor P | Complement factor properdin | PFC | PFD | Properidin | BFD | Properdin | Properdin P factor, complement
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence of human CFP (MVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKR).
Specificity
No cross reactivity with other proteins.
Applications
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
Applications should be user optimized.
Presentation
Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
After reconstitution, may be stored at 4°C for 1 month. For long-term storage and to avoid freeze-thaw cycles, aliquot and store at -20°C.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About Properdin / CFP
P27918 NM_002621 NP_002612.1

Publications (0)

Submit a Publication for LS-C756429

Customer Reviews (0)

Submit a review for LS-C756429

Featured Products

Properdin / CFP Antibody - Anti-CFP / Properdin antibody IHC of human tonsil. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml. This image was taken for the unconjugated form of this product. Other forms have not been tested.
Properdin / CFP Antibody (aa35‑84) LS‑B6914
Species: Human
Applications: IHC, IHC - Paraffin, Western blot
Product
Properdin / CFP Antibody LS‑C123316
Species: Human
Applications: IHC, IHC - Frozen, ELISA, Functional Assay
Properdin / CFP Antibody - Anti-CFP / Properdin antibody IHC of human tonsil. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml. This image was taken for the unconjugated form of this product. Other forms have not been tested.
Properdin / CFP Antibody (aa35‑84, FITC) LS‑C461650
Species: Human, Chimpanzee
Applications: IHC, IHC - Paraffin, Western blot
Properdin / CFP Antibody - Western blot of recombinant Properdin / CFP. This image was taken for the unconjugated form of this product. Other forms have not been tested.
Properdin / CFP Antibody (aa310‑459, Biotin) LS‑C300284
Species: Mouse
Applications: Western blot
Properdin / CFP Antibody - Western blot of CFP Antibody in CEM cell line lysates (35 ug/lane). CFP (arrow) was detected using the purified antibody.
Properdin / CFP Antibody (aa197‑223) LS‑C168709
Species: Human
Applications: Western blot, Flow Cytometry
Product
Properdin / CFP Antibody LS‑C147248
Species: Human
Applications: Immunodiffusion
See all Properdin / CFP Antibodies

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com
Requested From: United States
Date Requested: 11/23/2024
Family of Companies
Site Links Home All Antibodies How To Buy All Proteins Distributors All ELISA & Assay Kits Reviews PathPlus™ Antibodies
Follow LSBio View Cart Register or Login
Copyright © 2024 LifeSpan BioSciences, Inc - Privacy Policy
Contact Us

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Tel: (800) 227-6666 / (650) 697-3600

To place an order:
customerservice@vectorlabs.com

For questions about orders:
Customer.Support@LSBio.com

For technical assistance:
Technical.Support@LSBio.com