Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Location


Corporate Headquarters

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Telephone Numbers



Customer Service: (800) 227-6666 / (650) 697-3600


Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C782857-100 100 µg $575 
PCDH15 Antibody - IHC staining of FFPE mouse brain with PCDH15 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PCDH15 Antibody - IHC staining of FFPE mouse spleen with PCDH15 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PCDH15 Antibody - IHC staining of FFPE rat spleen with PCDH15 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PCDH15 Antibody - IHC staining of FFPE human prostate cancer with PCDH15 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PCDH15 Antibody - IHC staining of FFPE human rectal cancer with PCDH15 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PCDH15 Antibody - IHC staining of FFPE human tonsil with PCDH15 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PCDH15 Antibody - Western blot testing of 1) human placenta 2) human U-2 OS, 3) human HeLa, 4) rat brain, 5) rat lung, 6) mouse brain, 7) mouse lung, 8) mouse kidney, 9) mouse spleen and 10) mouse Neuro-2a lysate with PCDH15 antibody at 0.5ug/ml. Isoforms have been observed with molecular weights of: 250, 180, 160, 130, 90 and 60 kDa.
PCDH15 Antibody - IHC staining of FFPE mouse brain with PCDH15 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PCDH15 Antibody - IHC staining of FFPE mouse spleen with PCDH15 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PCDH15 Antibody - IHC staining of FFPE rat spleen with PCDH15 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PCDH15 Antibody - IHC staining of FFPE human prostate cancer with PCDH15 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PCDH15 Antibody - IHC staining of FFPE human rectal cancer with PCDH15 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PCDH15 Antibody - IHC staining of FFPE human tonsil with PCDH15 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
PCDH15 Antibody - Western blot testing of 1) human placenta 2) human U-2 OS, 3) human HeLa, 4) rat brain, 5) rat lung, 6) mouse brain, 7) mouse lung, 8) mouse kidney, 9) mouse spleen and 10) mouse Neuro-2a lysate with PCDH15 antibody at 0.5ug/ml. Isoforms have been observed with molecular weights of: 250, 180, 160, 130, 90 and 60 kDa.
1 of 7
2 of 7
3 of 7
4 of 7
5 of 7
6 of 7
7 of 7

Polyclonal Rabbit anti‑Human PCDH15 Antibody (IHC, WB) LS‑C782857

Polyclonal Rabbit anti‑Human PCDH15 Antibody (IHC, WB) LS‑C782857

Antibody:
PCDH15 Rabbit anti-Human Polyclonal Antibody
Application:
IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$575
LS-C782857-100
Toll Free North America
(800) 227-6666
For Research Use Only

Overview

Antibody:
PCDH15 Rabbit anti-Human Polyclonal Antibody
Application:
IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
PCDH15 antibody LS-C782857 is an unconjugated rabbit polyclonal antibody to PCDH15 from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Target
Human PCDH15
Synonyms
PCDH15 | Ames waltzer | CDHR15 | DFNB23 | Nmf19 | Protocadherin-related 15 | USH1F | Usher syndrome 1F | Protocadherin 15 | Protocadherin-15
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Antigen Affinity purification
Modifications
Unmodified
Immunogen
Amino acids DLTVYAIDPQTNRAIDRNELFKFLDGKLLDINKDFQ were used as the immunogen for the PCDH15 antibody.
Applications
  • IHC - Paraffin (1 - 2 µg/ml)
  • Western blot (0.5 - 1 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
Optimal dilution of the PCDH15 antibody should be determined by the researcher.
Presentation
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Reconstitution
Reconstitute with 0.2ml distilled water
Storage
After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About PCDH15
Q96QU1 NM_033056 NP_149045.3

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 3/22/2025