Human NDRG2

Rabbit

Human, Mouse, Rat (tested or 100% immunogen sequence identity)

Polyclonal

Unconjugated

Immunogen affinity purified

Unmodified

A synthetic peptide corresponding to a sequence at the C-Terminus of human NDRG2 (210-247 aa NSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFER), different from the related mouse and rat sequences by three amino acids.

aa210-247

Highly expressed in brain, heart, skeletal muscle and salivary gland, and moderately in kidney and liver. Expressed in dendritic cells, but not in other blood cells. Expression levels are low in pancreatic and liver cancer tissues; absent in meningioma. Expressed in low-grade gliomas but present at low levels in glioblastoma. Isoform 1 and isoform 2 are present in brain neurons and up-regulated in Alzheimer disease (at protein level). .

• IHC
• IHC - Paraffin (0.5 - 1 µg/ml)
• Western blot (0.1 - 0.5 µg/ml)

IHC: Antigen retrieval by boiling the paraffin sections in 10 mM citrate buffer, pH6.0, for 20 minutes is required for the staining of formalin/paraffin sections.

Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.

Add 0.2ml of distilled water will yield a concentration of 500µg/ml.

At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.

For research use only. Intended for use by laboratory professionals.

This antibody carries the LSBio 100% Guarantee.

Uniprot: Q9UN36 NCBI: NM_016250 NP_057334.1